(data stored in ACNUC7421 zone)

EMBL: CP001630.PE537

CP001630.PE537       Location/Qualifiers
FT   CDS_pept        complement(587651..587911)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0544"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0544"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34511"
FT                   /db_xref="UniProtKB/TrEMBL:C6WI60"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACU34511.1"
FT                   /translation="MASIEEVRAAIAQAVDKANESAKALQQAASLAEDAQALLNSATQG
FT                   SAQSDVESANAQFAQVASGVSDLQKYLENGISQAESINSRL"
     atggccagca tcgaagaagt ccgcgcggcg atcgcccagg ccgtggacaa ggccaacgag        60
     agcgcgaagg cgctccagca ggccgccagc ctcgccgagg acgcgcaggc cctgctcaac       120
     tcggcgaccc agggcagcgc ccagtccgac gtcgagtcgg cgaacgccca gttcgcgcag       180
     gtcgccagcg gtgtctcgga cctccagaag tacctggaga acgggatctc ccaggccgag       240
     agcatcaact ccaggctgtg a                                                 261
//

If you have problems or comments...

PBIL Back to PBIL home page