(data stored in ACNUC7421 zone)

EMBL: CP001630.PE538

CP001630.PE538       Location/Qualifiers
FT   CDS_pept        complement(588061..589773)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0545"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0545"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34512"
FT                   /db_xref="UniProtKB/TrEMBL:C6WI61"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACU34512.1"
FT                   /translation="MSGQDLELVITVVVTAHDERQALDACAGLLRRIGGRIVQTRDCSD
FT                   EEPGCWSLTVFKESGESAEHSVPAALTRAVRRFVRGLGEHFPTPKVACEPPTAWTVLDD
FT                   VHLLGPLVQGAERVLVEAWAGGDPLRRSPVPAPREERPPAPVPIAPAAAPAPRSAEPVI
FT                   PAQPDTAPPDAPEQDAEPPRAEPLALPEATPTAEPQTAPEPAEPQAPLATPEPVEPTAP
FT                   QEPLATPGPFAPAESQEPPATHEPLAPASAATPLEPSSFPVSPETPEPSSTPVSPEAPA
FT                   HPAAPVSPEAQVSPAGPVPPEAPPVPAPSPAPAAPRRPAGPTGSAPTWAGAAAAWPTPV
FT                   WPAPVWPAPVPTARPERGVVAPPPPGFPPGVEIPAISAVPAAPTGPAAPTGPAEPTGPA
FT                   EPAAPAEPAAPAEPSTTPFPVLPPAPPQPLPEPAPLPTPQDEPAPAPPEPLSDSPVRLI
FT                   LEIRAIADPTSPPEEQARSVARPLVPAGKITRVAPGGRLLAVHVDLGASEAPPTSALLD
FT                   AAAAMTPDGWSGVERVGISAVVRWSAGPTPTTGVTSLELTATPLSAFQWTEPA"
     atgagcggac aggacctgga actggtgatc acagtggtgg tcaccgccca cgacgagcgt        60
     caggcgctgg acgcctgcgc cgggttgctg cgccggatcg gcggtcggat cgtccagacg       120
     agggactgct ccgacgagga gcccggctgc tggtccctga cggtgttcaa ggagtcgggg       180
     gagagcgcgg agcacagcgt gcccgccgcc ctgaccaggg ccgtccgccg gttcgtccgg       240
     gggctgggcg agcacttccc caccccgaag gtcgcctgcg aacccccgac ggcgtggacg       300
     gtgctcgacg acgtccacct cctcggcccg ctggtccagg gcgcggaacg ggtgctggtc       360
     gaggcctggg cgggcggcga tccgctgcgc cgcagccccg tgcccgcccc gagggaggag       420
     cgccccccgg cgcccgtgcc gatcgctccg gcggcggcgc ccgcgccgcg gagcgcagag       480
     ccggtgatcc ccgcgcagcc ggacaccgcg cccccggacg cgcccgagca ggacgctgag       540
     ccgccgcgcg ccgagcccct ggcgctcccc gaggcgacgc cgaccgccga gccccagacg       600
     gcgcctgagc ccgccgagcc ccaggccccc ctggcgacgc ccgagcccgt cgagcccacc       660
     gcgccccagg agcccctggc gacgcctggc cccttcgcgc ccgccgagtc ccaggaaccc       720
     ccggcaacgc acgagcccct cgcgcctgcc agcgccgcga cccccctgga gccctcctcc       780
     ttcccggtgt ccccggagac cccggagccc tcctccaccc cggtgtcccc cgaggcccca       840
     gcgcaccccg cagccccggt gtcccctgaa gcccaggtgt cccccgctgg cccggttccc       900
     cctgaggccc caccggttcc ggccccctcc cccgcaccgg ccgccccccg gcgccccgca       960
     ggtcccaccg gcagcgcgcc gacctgggcg ggcgccgccg cggcgtggcc gacgccggtc      1020
     tggcccgccc cggtgtggcc cgcgcccgtc ccgaccgcgc ggccggagcg cggggtcgtc      1080
     gcgccgccgc cccccggttt cccgcccggc gtcgagatcc ccgccatctc ggcggtcccg      1140
     gccgccccca ccggtcccgc cgcccccacc ggtccagccg agcccaccgg tccagccgag      1200
     cccgcagccc ccgccgagcc cgcagccccc gccgagccct ccaccacgcc gttccccgtc      1260
     ctccccccgg ctcccccgca gcccctcccc gaacccgccc ccctgcccac cccgcaggac      1320
     gaaccagccc cggcaccccc cgagcccctc tcggactcgc ccgtccggct catcctggag      1380
     atccgcgcga tcgccgaccc gacctcgccc cccgaggagc aggcacggtc ggtagcgcgc      1440
     ccgctcgtcc cggccggcaa gatcacccgt gtggcccccg gtggacgact actggccgtg      1500
     cacgtcgacc tcggcgcgag cgaggcgccg cccacgtcgg cgctcctcga cgccgccgcc      1560
     gcgatgacac ccgacgggtg gtccggcgtc gagcgggtcg ggatctccgc ggtggtgcgc      1620
     tggtcagcgg ggcccacccc gacaacgggg gtcacctcgc tggaactgac ggcgacaccg      1680
     ctctcggcat tccagtggac ggagcccgcg tga                                   1713
//

If you have problems or comments...

PBIL Back to PBIL home page