(data stored in ACNUC7421 zone)

EMBL: CP001630.PE539

CP001630.PE539       Location/Qualifiers
FT   CDS_pept        590316..590795
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0546"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0546"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34513"
FT                   /db_xref="InterPro:IPR025734"
FT                   /db_xref="UniProtKB/TrEMBL:C6WI62"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACU34513.1"
FT                   /translation="MTGHTVLWDPVRLTAAEFAGCWEQLDLGEPPGALGLSDVDPVWPA
FT                   EVLVGLRRKGIALRGARLERQLRALARRDYAVDVDGCRVRVRASVVGSIGVLAERRGDE
FT                   VVLVSVPHYAVPAELLARLPESASVEVTRDGALVGASRCGPRDEAAELIERTRPG"
     ttgaccgggc acaccgtcct gtgggacccg gtccggctga ccgcggccga gttcgcgggc        60
     tgctgggagc agctcgacct cggcgagccg cccggcgcgc tcgggctgtc cgacgtggac       120
     ccggtgtggc ccgccgaggt gctggtcggg ttgcggcgca aggggatcgc gctgcgcggc       180
     gcccggttgg agcggcagct gcgggcgctg gcgcgccggg actacgcggt ggacgtcgac       240
     gggtgccggg tgcgggtgcg ggcctcggtg gtcggcagca tcggcgtgct cgccgagcgc       300
     cgaggcgacg aggtggtgct ggtgagcgtg ccgcactacg cggtgcccgc cgagctgctg       360
     gcccgcctgc cggagagcgc gtcggtcgag gtcaccaggg acggcgcgct ggtcggggcg       420
     agccggtgcg gcccgcgcga cgaggcggcc gagctgatcg agcgcacccg accgggctga       480
//

If you have problems or comments...

PBIL Back to PBIL home page