(data stored in ACNUC7421 zone)

EMBL: CP001630.PE54

CP001630.PE54        Location/Qualifiers
FT   CDS_pept        59060..60733
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0054"
FT                   /product="glycosyl transferase family 2"
FT                   /note="PFAM: glycosyl transferase family 2; KEGG:
FT                   rce:RC1_0824 glycosyl transferase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0054"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34028"
FT                   /db_xref="GOA:C6WDN3"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:C6WDN3"
FT                   /inference="protein motif:PFAM:PF00535"
FT                   /protein_id="ACU34028.1"
FT                   /translation="MTPRITFVLVTYGGGELAAHCLDVLAEHTPEPYEVVVVDSASPDG
FT                   SGEWLERNLTGATVVRMTENLGFGAGCNLGVQHARTEFVCFLNADVEVTEGWLAPLLEL
FT                   LDGTPAAAAAAPLMVFPDGRLQEAGSLLGGDAFSRGWGDGWEDGAELYPRVVDYASAAC
FT                   LVVRRRAFHDVGGFSSEYHIAYYEDTDLQFGLRDRGWQVWVQPSSHVVHVRHGTSSTAT
FT                   AERLSDINREVFRRRWADDLALRPPALGVHEHPHRLWWLRDKPASVRVLVVAPGAPADG
FT                   DRDAALLSAWRADPEAAVTLLVPEDAADDGAFARWRSRGVEVRPGDAGEASRERVGNYD
FT                   VVVALGDVPVEAVTRWQRAAVKALDLASLPHRAHERRFALSRAKEDAVRAGAARARTAE
FT                   LLQWADVVSCASEEDAEWVRGGAGATAHVLTHPVEAPPVLCELADRVTGDAAGDVDLAV
FT                   RRVLVAPFPGSAGLRPELVRAMAVGTPFVTTWEGADGLGLPGWVFECTEEQLLTDDELW
FT                   GRVHRELVAAHRARFAPERFRAVFADLQADCGVAPAPLVP"
     atgaccccgc ggatcacgtt cgtcctggtc acctacggcg gcggcgagct ggccgcgcac        60
     tgcctcgacg tgctcgccga gcacacgccc gagccgtacg aggtcgtggt cgtggacagc       120
     gcctccccgg acggcagcgg cgagtggctg gagcgcaacc tcaccggcgc gaccgtcgtg       180
     cggatgaccg agaacctcgg cttcggcgcg ggctgcaacc tgggcgtgca gcacgcgcgc       240
     accgagttcg tctgcttcct caacgccgac gtcgaggtca ccgagggctg gctggccccg       300
     ctgctggagc tgctcgacgg caccccggcc gccgccgcgg cggccccgct gatggtcttc       360
     ccggacggca ggctccagga ggcgggcagc ctcctcggcg gcgacgcgtt cagccggggc       420
     tggggcgacg gctgggagga cggggccgag ctgtacccga gggtggtcga ctacgcgtcg       480
     gccgcgtgcc tggtggtgcg gcgcagggcg ttccacgacg tcggcgggtt ctcctcggag       540
     taccacatcg cctactacga ggacaccgac ctgcagttcg ggctgcgcga ccggggctgg       600
     caggtgtggg tgcagccgtc ctcgcacgtc gtgcacgtgc ggcacggcac cagctccacg       660
     gccaccgccg agcggctgtc ggacatcaac cgcgaggtgt tccgccgccg ctgggccgac       720
     gacctggcgc tgcgcccgcc cgcgctgggc gtgcacgagc acccgcaccg gctgtggtgg       780
     ctgcgcgaca agcccgcctc ggtgcgggtc ctggtggtcg cgcccggcgc gcccgccgac       840
     ggggaccggg acgcggcgct gctctccgcg tggcgggccg accccgaggc ggcggtgacg       900
     ctgctggtgc ccgaggacgc cgccgacgac ggcgcgttcg cccgctggcg ctcgcgcggc       960
     gtcgaggtgc gccccggcga cgcgggcgag gccagccgcg agcgggtcgg caactacgac      1020
     gtcgtggtgg cgctcgggga cgtgcccgtg gaggcggtga cccgctggca gcgggccgcg      1080
     gtcaaggcgc tcgacctcgc ctcgctgccg caccgggcgc acgagcgccg gttcgcgctg      1140
     agccgcgcca aggaggacgc ggtccgggcg ggcgccgcgc gggccaggac ggccgagctg      1200
     ctccagtggg ccgacgtggt gtcctgcgcg tccgaggagg acgccgagtg ggtgcggggc      1260
     ggcgcgggcg cgaccgcgca cgtgctgacc caccccgtgg aggcgccccc ggtgctctgc      1320
     gagctggccg accgggtcac cggtgacgcg gccggtgacg tggacctggc cgtgcgccgg      1380
     gtgctcgtcg ccccgttccc cggatcggcg ggcctgcgcc cggagctggt cagggccatg      1440
     gcggtcggca cgccgttcgt caccacctgg gagggcgcgg acggcctcgg cctgcccggc      1500
     tgggtgttcg agtgcaccga ggagcagctg ctgaccgacg acgagctgtg ggggcgggtg      1560
     caccgcgagc tggtcgccgc ccaccgggcc cggttcgcgc ccgagcggtt ccgcgcggtc      1620
     ttcgccgacc tccaggccga ctgcggggtc gcccccgcgc cgctcgtgcc gtag            1674
//

If you have problems or comments...

PBIL Back to PBIL home page