(data stored in ACNUC7421 zone)

EMBL: CP001630.PE540

CP001630.PE540       Location/Qualifiers
FT   CDS_pept        complement(590868..591659)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0547"
FT                   /product="alpha/beta hydrolase fold protein"
FT                   /note="PFAM: alpha/beta hydrolase fold; KEGG: spe:Spro_0615
FT                   alpha/beta hydrolase fold"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0547"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34514"
FT                   /db_xref="GOA:C6WI63"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR022742"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:C6WI63"
FT                   /inference="protein motif:PFAM:PF00561"
FT                   /protein_id="ACU34514.1"
FT                   /translation="MIESNVPGRAGELVVRTWPNLEATWLAVLVHGCGEHAGRYGHVAE
FT                   ALVAAGALVVAADQAGHGASEGERALVEDLGTLVGDVDTVIGAAGVDLPVVLVGHGVGG
FT                   LVAARYAQDHQDRLAALVLSAPVLGAWEGLDALGGDDLSGTEVDPAELSRDEEVGRAYA
FT                   ADPLVWHGPVPRPTLEAVERAIDEVNFGPVLDRVPVLWLHGGADRLVPEADTRTGADRL
FT                   RGARFEERVYPGARHEVLRETNRDEVLGDVVDFARRALGGS"
     gtgatcgagt cgaacgttcc cggacgcgcc ggtgagctgg tcgtgcggac ctggccgaac        60
     ctggaggcca cctggttggc ggtgctcgtg cacgggtgcg gggagcacgc cgggcggtac       120
     gggcacgtcg ccgaggccct ggtggcggcg ggcgcgctgg tggtcgcggc ggaccaggcc       180
     gggcacgggg cgtcggaggg cgagcgggct ctggtcgagg acctcgggac gctcgtcggc       240
     gacgtcgaca ccgtgatcgg cgcggccggg gtggacctgc cggtggtgct ggtcgggcac       300
     ggcgtcggcg gcctggtggc ggcccggtac gcgcaggacc accaggaccg gctcgccgcg       360
     ctggtgctgt ccgcgcccgt gctgggcgcg tgggagggcc tggacgcgct cggcggcgac       420
     gacctgtccg gcacggaggt cgacccggcc gagctgtccc gcgacgagga ggtcggccgc       480
     gcgtacgccg ccgacccgct ggtgtggcac ggcccggtgc cccggccgac cctggaggcg       540
     gtggagcggg cgatcgacga ggtgaacttc gggccggtgc tggaccgggt gccggtgctg       600
     tggctgcacg gcggggccga ccggctggtc cccgaggccg acacgcgcac cggggcggac       660
     cggctgcgcg gggcgcggtt cgaggagcgg gtctatccgg gggcgcggca cgaggtgctg       720
     cgcgagacga accgggacga ggtgctcggc gacgtggtcg acttcgccag gcgggcgttg       780
     ggcgggagct ga                                                           792
//

If you have problems or comments...

PBIL Back to PBIL home page