(data stored in ACNUC7421 zone)

EMBL: CP001630.PE541

CP001630.PE541       Location/Qualifiers
FT   CDS_pept        complement(591709..592527)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0548"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="PFAM: LysR substrate-binding; regulatory protein
FT                   LysR; KEGG: dvm:DvMF_0511 transcriptional regulator, LysR
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0548"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34515"
FT                   /db_xref="GOA:C6WI64"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:C6WI64"
FT                   /inference="protein motif:PFAM:PF03466"
FT                   /protein_id="ACU34515.1"
FT                   /translation="MDTRLLRTLLVLARTGSFTATAAELHLVQSSVTSQVKVLERHLGA
FT                   RLFDRLPQGARLTEAGRKAVENARDVLSAEQRLLDAVRGSTEVEGDVRIGAPESVCAYR
FT                   LPQRIADAALRWPGITVHLSPAGTKEVLLGVRRGTLDLGLALDDGLVAPGLSAHPVGVE
FT                   PIELVAAPGAVAEDRYFLLEEGCSYTDRFVRELRGRRPQITRFGSIEAVRSCVVAGLGW
FT                   TVLPRVAVAEQLESGALRRLGELPDSTLYLVTDPRRTLPAAVRAVAEAVL"
     atggacaccc ggttgctgcg caccctgctg gtactcgcgc gaaccgggag cttcaccgcc        60
     acagccgccg agctgcacct ggtccagtcc tcggtgacca gtcaggtcaa ggtcctggaa       120
     cggcacctgg gggcgcggct gttcgaccgg ctgccgcagg gcgcgcggct caccgaggcc       180
     gggcggaagg cggtggagaa cgcgcgcgac gtgctgtccg ccgagcagcg gctgctggac       240
     gcggtgcggg gcagcaccga ggtcgagggc gacgtgcgga tcggcgcgcc ggagtcggtg       300
     tgcgcctacc ggctgccgca gcggatcgcg gacgcggcgc tgcgctggcc gggcatcacc       360
     gtgcacctgt cccccgccgg gaccaaggag gtgctgctcg gggtgcggcg cggcacgctc       420
     gacctggggc tcgcgctgga cgacggcctc gtcgcccccg gcctgtccgc gcacccggtc       480
     ggggtggagc cgatcgagct ggtggccgcg ccgggcgcgg tggcggagga ccggtacttc       540
     ctgctggagg agggctgctc ctacaccgac cggttcgtgc gggagctgcg cgggcgacga       600
     ccgcagatca cccggttcgg gagcatcgag gcggtgcggt cgtgcgtggt ggcgggtctg       660
     gggtggacgg tgctgccgag ggtcgcggtg gccgagcagc tggagagcgg ggcgctgcgg       720
     cggctcgggg agctgccgga cagcaccctg tacctggtca ccgaccccag gcgcacgctg       780
     cccgcggcgg tccgcgcggt ggcggaggcg gtgctgtag                              819
//

If you have problems or comments...

PBIL Back to PBIL home page