(data stored in ACNUC7421 zone)

EMBL: CP001630.PE542

CP001630.PE542       Location/Qualifiers
FT   CDS_pept        592602..593429
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0549"
FT                   /product="phenazine biosynthesis protein PhzF family"
FT                   /note="TIGRFAM: phenazine biosynthesis protein PhzF family;
FT                   PFAM: Phenazine biosynthesis PhzC/PhzF protein; KEGG:
FT                   aha:AHA_2368 putative phenazine biosynthesis protein PhzF"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0549"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34516"
FT                   /db_xref="GOA:C6WI65"
FT                   /db_xref="InterPro:IPR003719"
FT                   /db_xref="UniProtKB/TrEMBL:C6WI65"
FT                   /inference="protein motif:TFAM:TIGR00654"
FT                   /protein_id="ACU34516.1"
FT                   /translation="MSNVLRYAAFTTTPTGGNPAGVVLDARGLTPERMLATAAEVGYSE
FT                   TAFLLPGPDPRRFAVRYFSPEAEVPFCGHATVAAAVALGLPGAIALDTAAGEVLVDVDG
FT                   GTATLTSVPTRTRPAPDADVDAALAALRWSRADLDPELPVRWAFGGGWHLVVAVRDRAV
FT                   LAALDYDFPALRALLAGADALTAQLVHRRAPDLFDARDPFPVGGVVEDPATGAAAAAFG
FT                   GYLRELGQLPDGGRFVLHQGVDMGRPSELVVVAEPGAPGVRVTGAAVPIDALG"
     atgtcgaacg tcctgcgcta cgccgccttc accaccaccc cgaccggcgg gaaccccgcc        60
     ggcgtcgtcc tcgacgcgcg ggggctgacc cccgagcgga tgctcgcgac cgccgccgag       120
     gtcggctact ccgagaccgc cttcctgctg cccggccccg acccgcgccg gttcgcggtc       180
     cgctacttca gccccgaggc cgaggtgccg ttctgcgggc acgccaccgt cgcggcggcc       240
     gtcgccctcg gcctgcccgg cgcgatcgcg ctggacacgg cggcgggcga ggtgctggtc       300
     gacgtcgacg gcggcacggc caccctgacc agcgtcccga cccgcaccag gcccgcgccg       360
     gacgccgacg tcgacgccgc gctcgccgcg ctgcgctggt cgcgcgccga cctggacccg       420
     gagctgccgg tgcgctgggc gttcggcggc gggtggcacc tggtggtggc ggtgcgcgac       480
     cgggccgtgc tggccgccct ggactacgac ttccccgcgc tgcgcgccct gctggcgggc       540
     gccgacgccc tcaccgcgca gctggtgcac cgccgcgcgc ccgacctgtt cgacgcccgc       600
     gacccgttcc cggtgggcgg ggtggtggag gacccggcga ccggggccgc ggcggcggcg       660
     ttcggcgggt acctgcggga gctggggcag ctgccggacg gcgggcggtt cgtgctgcac       720
     cagggggtcg acatggggcg gccgagcgag ctggtcgtgg tggccgagcc gggcgcgccg       780
     ggcgtgcggg tcaccggggc ggccgtgccg atcgacgcgc tgggctga                    828
//

If you have problems or comments...

PBIL Back to PBIL home page