(data stored in ACNUC7421 zone)

EMBL: CP001630.PE543

CP001630.PE543       Location/Qualifiers
FT   CDS_pept        593919..594908
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0550"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="PFAM: LysR substrate-binding; regulatory protein
FT                   LysR; KEGG: bcm:Bcenmc03_5299 LysR family transcriptional
FT                   regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0550"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34517"
FT                   /db_xref="GOA:C6WI66"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:C6WI66"
FT                   /inference="protein motif:PFAM:PF03466"
FT                   /protein_id="ACU34517.1"
FT                   /translation="MPELELRHLRAVCAIAEEGSLTKAASRLGLTQPAMSAQLRTVERI
FT                   VGGRLFERTPGGSVPTELGRQVVGSARLVLDEVGGLVRLARERSSGADRGPLLVGSVPT
FT                   LFFGDLVTELRRAVPGVEIRTETMQGGSELLEKLVAGQFHVAVLDWFEGLDTRELRGVE
FT                   VRRLVSEPHFVALPEWDRLARQDEVDLAELADRDWVTPPDQFIGNRLQIVAACAGAGFT
FT                   PRFTHHANEASSARGLVASGAVCFALPQSRGGDGIVVKPLKGSPLLIDVLVATRRDGPV
FT                   AGRAHEVYACAARAYRALLPRNPAFEKWWADHPEAHAELDTALLVDPA"
     atgcccgagt tggagctgcg ccacctgcgc gcggtgtgcg cgatcgccga ggagggcagc        60
     ctcaccaagg ccgcctcgcg gctgggcctc acccagccgg ccatgagcgc ccagctgcgc       120
     acggtcgagc ggatcgtcgg cggcaggctg ttcgagcgca cgcccggcgg cagcgtgccc       180
     accgagctgg gcaggcaggt cgtcggctcg gccaggctcg tgctggacga ggtcggcggg       240
     ctggtgcggc tggccaggga gcgcagctcg ggcgccgacc ggggtccgct gctggtgggg       300
     agcgtgccga cgctgttctt cggcgacctc gtcaccgagc tgcgccgcgc cgttcccggc       360
     gtcgagatcc gcaccgagac catgcagggc gggtccgagc tgctggagaa gctggtcgcg       420
     ggccagttcc acgtggcggt gctcgactgg ttcgagggcc tggacacccg cgagctgcgc       480
     ggcgtcgagg tgcgcaggct ggtgagcgaa ccgcacttcg tggcgctgcc cgagtgggac       540
     cggctcgccc ggcaggacga ggtcgacctc gccgagctgg ccgaccgcga ctgggtcacc       600
     ccgcccgacc agttcatcgg caaccggctg cagatcgtcg ccgcgtgcgc gggcgccggg       660
     ttcacgcccc ggttcaccca ccacgccaac gaggccagca gcgcgcgcgg gctcgtcgcc       720
     agcggcgcgg tgtgcttcgc gctcccgcag tcgcggggcg gcgacggcat cgtggtcaag       780
     ccgctcaagg gctcgccgct gctgatcgac gtcctggtgg cgacccgccg cgacggcccg       840
     gtcgcggggc gggcccacga ggtctacgcg tgcgcggcgc gggcgtaccg ggcgctgctg       900
     ccgaggaacc cggcgttcga gaagtggtgg gccgaccacc cggaggccca cgccgagctg       960
     gacacggcgc tgctggtcga cccggcgtga                                        990
//

If you have problems or comments...

PBIL Back to PBIL home page