(data stored in ACNUC7421 zone)

EMBL: CP001630.PE544

CP001630.PE544       Location/Qualifiers
FT   CDS_pept        complement(594981..595796)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0551"
FT                   /product="NmrA family protein"
FT                   /note="PFAM: NmrA family protein; short-chain
FT                   dehydrogenase/reductase SDR; KEGG: mxa:MXAN_5100 NmrA
FT                   family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0551"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34518"
FT                   /db_xref="InterPro:IPR008030"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C6WI67"
FT                   /inference="protein motif:PFAM:PF05368"
FT                   /protein_id="ACU34518.1"
FT                   /translation="MTTLITGATGHLGALIADHVLTRIPASELAVSTRSPEKAEALSAR
FT                   GVDVRKADFDDAESLRAAFAGVDRLVLVSADGPDRIAQHTRVVEAAKAAGVSFIAYTSV
FT                   VDADTSTLSLAPDHAATERVIRESGIAFAFLRNGMYHENYTQALGHGVVAHAAGDGRNA
FT                   SASRHDLAEAAAVVVTGEGHEGKVYELTGPSAWTFAELAALAGDEAKPVTAQERIAGLV
FT                   GFGLPDFVAELLTDIEVNIGRGALERVTDDLPTLLGRPATPIAEAVANR"
     atgaccacgc tgatcaccgg ggccaccggc cacctgggcg ccctcatcgc cgaccacgtc        60
     ctcacccgca tcccggcctc ggagctggcc gtctcgaccc gctcgccgga gaaggccgag       120
     gcgctctccg ctcgcggggt cgacgtgcgc aaggccgact tcgacgacgc cgagtccctg       180
     cgcgcggcgt tcgcgggcgt ggaccggctc gtgctggtgt cggcggacgg gccggaccgg       240
     atcgcccagc acacccgcgt ggtcgaggcc gccaaggccg cgggtgtctc gttcatcgcc       300
     tacacgagcg tggtggacgc cgacacgtcc acgctctccc tcgcccccga ccacgcggcg       360
     accgagcggg tcatccgcga gtccgggatc gcgttcgcgt tcctgcgcaa cggcatgtac       420
     cacgagaact acacccaggc gctgggccac ggggtcgtcg cgcacgccgc cggtgacggc       480
     cgcaacgcca gcgcctcccg ccacgacctg gccgaggccg ccgcggtcgt cgtcaccggc       540
     gagggccacg agggcaaggt ctacgagctg accgggccga gcgcgtggac gttcgccgag       600
     ctggccgcgc tggcgggcga cgaggcgaag ccggtgacgg cgcaggagcg gatcgccggg       660
     ctggtcgggt tcgggctgcc cgacttcgtg gcggagctgc tgaccgacat cgaggtcaac       720
     atcgggcggg gcgcgctgga gcgcgtcacc gacgacctgc cgaccctgct gggccgcccg       780
     gccaccccga tcgccgaggc ggtcgcgaac cgctga                                 816
//

If you have problems or comments...

PBIL Back to PBIL home page