(data stored in ACNUC7421 zone)

EMBL: CP001630.PE545

CP001630.PE545       Location/Qualifiers
FT   CDS_pept        595883..596269
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0552"
FT                   /product="transcriptional regulator, HxlR family"
FT                   /note="PFAM: helix-turn-helix HxlR type; KEGG:
FT                   mxa:MXAN_5099 putative transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0552"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34519"
FT                   /db_xref="InterPro:IPR002577"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:C6WJ87"
FT                   /inference="protein motif:PFAM:PF01638"
FT                   /protein_id="ACU34519.1"
FT                   /translation="MDGMATTGDVYDRNCPSRQIASHATSQWGGLVLGKLLEGKLRFSE
FT                   LRRAVVGVSEKMLAQTLQALERDGLVLREVHPVIPPHVDYSLTPAGAQLAARVRGLYDW
FT                   IEDNLPDLCAARDAYDAKRAGTTV"
     gtggacggca tggcgacgac gggtgacgtg tacgaccgca actgcccctc ccggcagatc        60
     gccagccacg ccacgagcca gtggggcggg ctggtcctcg gcaagctcct ggagggcaag       120
     ctgcggttca gcgagctgcg cagggcggtc gtgggcgtca gcgagaagat gctggcccag       180
     accctgcagg cgctggagcg cgacggcctg gtgctgcgcg aggtccaccc ggtcatcccc       240
     ccgcacgtcg actactccct caccccggcg ggcgcgcagc tcgccgcgcg ggtgcgcggc       300
     ctctacgact ggatcgagga caacctcccc gacctgtgcg ccgccaggga cgcctacgac       360
     gccaagcgcg cggggaccac cgtgtga                                           387
//

If you have problems or comments...

PBIL Back to PBIL home page