(data stored in ACNUC7421 zone)

EMBL: CP001630.PE546

CP001630.PE546       Location/Qualifiers
FT   CDS_pept        596361..597458
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0553"
FT                   /product="AIG2 family protein"
FT                   /note="PFAM: AIG2 family protein; KEGG: pae:PA4164
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0553"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34520"
FT                   /db_xref="InterPro:IPR009288"
FT                   /db_xref="InterPro:IPR013024"
FT                   /db_xref="InterPro:IPR036568"
FT                   /db_xref="UniProtKB/TrEMBL:C6WJ88"
FT                   /inference="protein motif:PFAM:PF06094"
FT                   /protein_id="ACU34520.1"
FT                   /translation="MGGIRKHTASGAALALPFTDDRHPAEPYPGARPGACFVHLDGAGW
FT                   PVDPDPMTDSGWRVSPDGVDLDEWLAGHGEPPMAERTPVLAYGSNANPAKVTWLREELG
FT                   LTGPAVVLRARCEGLAAVWASGLRKVDGQRPATLAAMPDVTEEHAVWFATAEQLRVLDR
FT                   CEGRGLRYRLVRVHSGRVTLFDGSVVDSVLAYTGAGRRRMPLLSAGEPVRCAEVDQVGA
FT                   RWLGGRPAPDDGLDVTPVHGYPAPDEWPDRLFAYGTLQPGQSAWGLVEPLTSGSPEPAR
FT                   ASGTLHDTGLGYPALRPGGGGANVPGHVLRLTSPEEALPVLDKYEGDEYRRVRVTLPDG
FT                   RVCWTYLWRGPVDGFAELPEGWVRR"
     atgggcggca tacggaagca cacggctagc ggggcggcac tggcgctgcc cttcacggac        60
     gaccggcacc ccgcggagcc ctaccccggc gctcggccgg gtgcctgctt cgttcacctg       120
     gacggtgcgg gttggccggt agacccggac ccgatgactg actcggggtg gcgggtttcc       180
     cccgacgggg tggacctgga cgagtggctg gccgggcacg gcgagccgcc gatggcggag       240
     cggaccccgg tgctggccta cgggtccaac gccaaccccg ccaaggtcac ctggttgcgc       300
     gaggagctcg gtctcaccgg tcccgcggtg gtgctgcgcg ccaggtgcga ggggctggcg       360
     gcggtgtggg cctcgggcct gcgcaaggtc gacggccagc ggcccgcgac cctggccgcc       420
     atgccggacg tcaccgagga gcacgcggtc tggttcgcga ccgccgagca gctgcgcgtc       480
     ctggaccgct gcgaggggcg cgggctgcgc taccggctgg tccgcgtgca cagcggccgg       540
     gtcaccctgt tcgacggctc ggtggtcgac tcggtgctcg cctacaccgg cgcgggccgc       600
     aggcggatgc cgctgctgtc ggccggtgag ccggtgcgct gcgccgaggt cgaccaggtg       660
     ggggcgcgct ggctcggcgg gcggcccgcg cccgacgacg gcctcgacgt caccccggtc       720
     cacggctacc cggcgcccga cgagtggccg gaccgcctgt tcgcctacgg gacgctccag       780
     ccggggcaga gcgcgtgggg gctcgtcgag cccctcacca gcggctcgcc cgagcccgcg       840
     cgggcgtccg ggacgctgca cgacaccggg ctcggctacc cggcgctgcg ccccggcggc       900
     gggggcgcga acgtgccggg ccacgtgctg cggctgacct cgccggagga ggcgctgccg       960
     gtgctggaca agtacgaggg cgacgagtac cggcgggtcc gggtgaccct gccggacggg      1020
     cgggtgtgct ggacgtacct gtggcgcggg ccggtcgacg ggttcgcgga gctgccggag      1080
     gggtgggtgc gacggtga                                                    1098
//

If you have problems or comments...

PBIL Back to PBIL home page