(data stored in ACNUC7421 zone)

EMBL: CP001630.PE547

CP001630.PE547       Location/Qualifiers
FT   CDS_pept        597634..598308
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0554"
FT                   /product="peptidase C14, caspase catalytic subunit P20"
FT                   /note="KEGG: rpc:RPC_3182 peptidase C14, caspase catalytic
FT                   subunit P20"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0554"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34521"
FT                   /db_xref="InterPro:IPR025326"
FT                   /db_xref="UniProtKB/TrEMBL:C6WJ89"
FT                   /inference="similar to AA sequence:KEGG:RPC_3182"
FT                   /protein_id="ACU34521.1"
FT                   /translation="MRRRLIAVCGVALAGVLAACGGGARPAAEQGELTGALTTEAAPSS
FT                   AATGSSGPGASVEGAPNSADPGGGADPVPPSEPGGQPPGAGGRCTAASLTGRFQPTDAG
FT                   AGNRHGMFVVTNTGDRTCTLTGYSGLQLLDAAGGPVPTDLVRTGRPAPEPVVVEPGASA
FT                   SADLRWTVVPTGDEPVEGPCEPQPASAAAIPPDETQPLTVTWPGGPVCGGGKIEISPFR
FT                   AA"
     atgaggcgac ggctgatcgc ggtgtgcggg gtggcgctgg ccggggtgct cgccgcgtgc        60
     ggcggcggcg cccgccccgc agccgagcag ggcgagctca cgggcgcgct cacgacggag       120
     gccgcgccga gcagcgcggc gaccgggtcg agcgggccgg gcgcctcggt ggagggcgcc       180
     ccgaacagcg cggaccccgg tggcggcgcg gacccggtgc cgcccagcga gccgggcggg       240
     cagccgccgg gcgcgggggg ccgctgcacg gcggcgtccc tgaccggccg gttccagccg       300
     accgacgcgg gggcgggcaa ccggcacggg atgttcgtgg tgaccaacac cggcgaccgg       360
     acgtgcacgc tcaccggcta cagcggcctg cagctgctcg acgccgcggg cggcccggtc       420
     ccgacggacc tggtccgcac cggccggccc gcgcccgagc cggtcgtcgt ggaaccgggc       480
     gcgtcggcgt cggcggacct gaggtggacc gtggtgccga ccggcgacga gccggtggag       540
     ggcccctgcg agccgcagcc ggcgagcgcg gcggcgatcc ccccggacga gacccagccg       600
     ctcacggtga cctggccggg aggcccggtg tgcggcggcg ggaagatcga gatcagcccg       660
     ttccgcgcgg cctga                                                        675
//

If you have problems or comments...

PBIL Back to PBIL home page