(data stored in ACNUC7421 zone)

EMBL: CP001630.PE548

CP001630.PE548       Location/Qualifiers
FT   CDS_pept        complement(598611..600047)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0555"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: hha:Hhal_1735 putative ABC transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0555"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34522"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C6WJ90"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACU34522.1"
FT                   /translation="MVNGSVVGSGPVGSGAVGLEARVGALLDEALALYRDSPRAVSWLR
FT                   GHRARFAEPVRVAVAGGHGTGKSTLVSALVGEELTAPPTATAWYRDGARPAAWVGAHEV
FT                   PVVRRDDGVRVEAGGAERVVVEWPARSLRDLVLVDTRPDAPVELVFGEADAVLHLTRHV
FT                   RDEDLERLRAGHDHPIARAAPVTTLLVLARADEIGGGRIDALSSAKQIARRCRRDPAVR
FT                   GLCQDAVAFAGLLAVASRTLRDEEFAALGALSGLARAELDGHLLSADRFAGEDFPVALG
FT                   ASARQRLLDRLGLFGVRLCTTLIRQGFDTRVKLTGQLAQRSGLGELREAIGAHLTERRG
FT                   ALKARSALLGLDVVLRAEPRPGSVGLLGALERVVAGAHDFRELRLLAALAGGRVSLPGE
FT                   LGEEATRLVGGAGTGAAARLGAEEQGLSGRELRHLLLDVLGRWREHAASPVLDNAQRRA
FT                   AGVVVRSCEGVLVERGGVAG"
     gtggtgaacg ggagcgtggt ggggtccggg cccgtggggt cgggcgcggt ggggctggag        60
     gcgcgggtcg gggcgctgct cgacgaggcg ctggcgctgt accgggacag cccgagggcg       120
     gtgtcgtggc tgcgcgggca ccgggcgcgg ttcgccgagc cggtgcgggt ggcggtggcg       180
     ggcgggcacg ggaccggcaa gtcgacgctg gtgagcgcgc tggtcggcga ggagctcacc       240
     gcgccgccga ccgcgaccgc ctggtaccgc gacggggcgc ggcccgcggc gtgggtgggc       300
     gcgcacgagg tgccggtggt gcgccgcgac gacggggtgc gggtggaggc cggtggcgcg       360
     gagcgggtcg tggtcgagtg gcccgcgcgg tcgctgcgcg acctggtgct ggtggacacg       420
     cggccggacg cgccggtcga gctggtgttc ggcgaggcgg acgcggtgct gcacctgacc       480
     aggcacgtgc gcgacgagga cctggagcgg ctgcgcgccg ggcacgatca cccgatcgcg       540
     cgggcggctc cggtgacgac gctgctggtg ctggcgcggg ccgacgagat cggcggcggg       600
     cggatcgacg cgctgtcgtc ggccaagcag atcgcccggc ggtgcaggcg ggacccggcg       660
     gtgcgggggc tgtgccagga cgcggtggcg ttcgcggggc tgctggcggt ggcgtcgcgc       720
     acgctcaggg acgaggagtt cgccgcgctc ggggcgctgt cggggctggc gcgggcggag       780
     ctggacgggc acctgctgtc ggcggaccgg ttcgcgggcg aggacttccc ggtggcgctg       840
     ggcgcgtcgg cgcggcagcg gctgctggac cgactggggc tgttcggggt gcggctgtgc       900
     acgaccctga tcaggcaggg cttcgacacg cgggtgaagc tgaccggtca gctggcccag       960
     cgcagcgggc tcggcgagct gcgggaggcg atcggggcgc acctgaccga gcggcgcggg      1020
     gcgctgaagg cccggtcggc gctgctgggc ctggacgtgg tcctgcgcgc cgaaccgcga      1080
     ccggggtcgg tggggctgct gggggcgctg gagcgggtgg tggcgggggc gcacgacttc      1140
     cgcgagctgc gcctgctggc cgcgctggct ggtgggcggg tgagcctgcc gggtgagctg      1200
     ggcgaggagg cgaccaggct ggtcggcggc gcggggacgg gtgcggcggc gaggttgggg      1260
     gcggaggagc aggggctgtc ggggcgggag ctgcggcacc tgctgctgga cgtgctgggg      1320
     cgctggcgcg agcacgcggc gagcccggtg ctggacaacg cccagcggcg ggcggcgggg      1380
     gtggtggtgc gcagctgcga gggggtgctg gtggagaggg gcggggtggc ggggtga         1437
//

If you have problems or comments...

PBIL Back to PBIL home page