(data stored in ACNUC7421 zone)

EMBL: CP001630.PE549

CP001630.PE549       Location/Qualifiers
FT   CDS_pept        complement(600103..601911)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0556"
FT                   /product="GTP-binding protein HSR1-related"
FT                   /note="PFAM: GTP-binding protein HSR1-related; KEGG:
FT                   scl:sce0387 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0556"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34523"
FT                   /db_xref="InterPro:IPR022812"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C6WJ91"
FT                   /inference="protein motif:PFAM:PF01926"
FT                   /protein_id="ACU34523.1"
FT                   /translation="MSAPWLDVLDDTIRACAARNRPDLAARLREKRASQLDPRIRVLVV
FT                   GESKQGKSQLVNALINAPVCAVGDDVTTAVPTFVQHAETPSATLLRGGSIADTPTERIP
FT                   VPIDQVARAVSGRAGGEVLAAEVGIPRELLASGLVLIDTPGTGDPRGARAASTYAALLQ
FT                   ADAVLMVTDATAELSASELELLRRVLAACPNVTVVLTKTDLSAQWRQVLQRDRAHLARA
FT                   GVGAKVLPVSSALRLRAARTGDRELNAESGFPELLACVQRDIVAAADVLGRRSVAAAAA
FT                   SAVKQLVAPLKEELASMGARGPEDTIAALHEAQRRVDELRRRSARWQTVLADEMADLVS
FT                   DVEYDLRDRTRGILREVDRTFETADPGKVWDEFEPWLRTSLTEAATTNFAWLLERAEWV
FT                   AEKVARSFPVHRDDLLPESVFPDDLLDRVAEMDAPTLERFTASQKFFTGLRGSYGGVLM
FT                   LGLVTSLAGMPLINAVSLGAGALFGGRSVLEEGEQRLKRRQAAAKQSVQRHVDDFFVKF
FT                   SKDCRDAARHVQRSLRDHFSTIAEELQETLLESARSARRAVQDDATERERRTREAKGEL
FT                   DGLVQLYQRVQAVAGVGAATPLSITA"
     atgtccgctc cgtggctcga cgtgctcgac gacacgatca gggcctgcgc cgcccgcaac        60
     cgccccgacc tggccgccag gctgcgcgag aagcgcgcga gccagctgga cccgaggatc       120
     cgggtgctcg tcgtcggcga gtccaagcag ggcaagagcc agctggtgaa cgcgctgatc       180
     aacgcgccgg tgtgcgcggt cggcgacgac gtgacgacgg ccgtgcccac gttcgtgcag       240
     cacgccgaga cgccgtccgc gacgctgctg cgcggcgggt cgatcgcgga caccccgacc       300
     gagcgcatcc cggtgcccat cgaccaggtg gcgcgcgcgg tgagcgggcg cgcgggcggc       360
     gaggtgctgg cggccgaggt cggcatcccg cgcgagctgc tggcgtccgg gctggtgctg       420
     atcgacaccc ccggcaccgg ggacccgcgc ggggcgcgcg cggccagcac ctacgcggcg       480
     ctgctccagg ccgacgcggt gctgatggtc accgacgcga ccgccgagct gtcggcgtcc       540
     gagctggagc tgctgcgccg ggtcctggcg gcctgcccga acgtgaccgt ggtgctgacc       600
     aagaccgacc tctccgcgca gtggcggcag gtgctccagc gcgatcgcgc gcacctcgcg       660
     cgcgccgggg tgggcgcgaa ggtgctgccg gtgtcctcgg cgctgcggct gcgcgcggcc       720
     aggaccggcg accgggagct gaacgccgag tccgggttcc cggagctgct ggcgtgcgtg       780
     cagcgcgaca tcgtggcggc ggcggacgtg ctcggccgcc ggtcggtggc cgcggcggcg       840
     gcgtcggcgg tcaagcagct ggtggccccg ctcaaggagg agctggccag catgggggcg       900
     cgcggccccg aggacacgat cgccgcgctg cacgaggcgc agcggcgggt ggacgagctg       960
     cggcggcggt ccgcgcggtg gcagaccgtg ctcgccgacg agatggccga cctggtgtcg      1020
     gacgtggagt acgacctgcg ggaccggacc aggggcatcc tgcgggaggt cgaccgcacc      1080
     ttcgagaccg ccgatccggg gaaggtctgg gacgagttcg agccgtggct gcgcaccagc      1140
     ctgaccgagg cggcgacgac gaacttcgcg tggctgctgg agcgggccga gtgggtcgcg      1200
     gagaaggtgg cgcgcagctt cccggtgcac cgggacgacc tgctgcccga gtcggtgttc      1260
     cccgacgacc tgctcgaccg ggtggcggag atggacgcgc ccacgttgga gcggttcacc      1320
     gcgagccaga agttcttcac cgggctgcgc gggtcgtacg ggggcgtgct gatgctcggg      1380
     ctggtgacca gcctggccgg gatgccgctg atcaacgcgg tgtcgctcgg cgcgggggcg      1440
     ctgttcggcg ggcggtcggt gctggaggag ggcgagcagc ggctcaagcg tcggcaggcc      1500
     gccgcgaagc agtccgtgca gcggcacgtg gacgacttct tcgtgaagtt cagcaaggac      1560
     tgccgggacg cggcgcggca cgtgcagcgg agcctgcgcg accacttcag caccatcgcc      1620
     gaggagctgc aggagacgct gctggagtcg gcgcgcagcg cgcggcgggc ggtgcaggac      1680
     gacgcgaccg agcgggagcg gcgcacgcgc gaggccaagg gcgagctgga cgggctggtg      1740
     cagctgtacc agcgggtgca ggcggtggcc ggggtcggcg cggcgacccc gctgagcatc      1800
     acggcgtag                                                              1809
//

If you have problems or comments...

PBIL Back to PBIL home page