(data stored in ACNUC7421 zone)

EMBL: CP001630.PE55

CP001630.PE55        Location/Qualifiers
FT   CDS_pept        complement(60861..64376)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0055"
FT                   /product="glycosyl transferase family 2"
FT                   /note="PFAM: glycosyl transferase family 2;
FT                   Methyltransferase type 12; Methyltransferase type 11; KEGG:
FT                   ppf:Pput_3926 glycosyl transferase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0055"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34029"
FT                   /db_xref="GOA:C6WDN4"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR013216"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:C6WDN4"
FT                   /inference="protein motif:PFAM:PF00535"
FT                   /protein_id="ACU34029.1"
FT                   /translation="MVEQPVYADGAEDEVLSRLRRAADVSAGSAELARALPSWELIYHF
FT                   SPQRTALLAPIELVEGTRVLDFGCGSGVLTRAMGELGAGVVGVEGTPTRAEAARERCRD
FT                   LPNVRIVDGGAEEIGLNGPFDLALLCGVLEYSSVYGDGPEALLEDVVGALEPGGALVLA
FT                   IENKIGLGYLTGRPEDHHGKSWVGLADYPRGGARTWPRAELAELLANAGLTAQRWMLPY
FT                   PDYKLPRVIVDADVHGRGDAVDLVDKLVRDPLYGAFGGTTGAVPGRSLHRTAVVEGFGA
FT                   SVSPSFLVVAARTPEAVRRFVRPGLGWLVNSARLPRWRRSRVLTTALELRAVEGAGAES
FT                   DWLRQEAPAVEPLLPGRPLDSLLLEALARGDEEELRGLLGLWRSCCEEGATGLGDQPRH
FT                   PFLPGAPGVPVLAANALDVHPGNVVLLPDGSPRRIDLEWCAGEGVDAELVLVRALLEFA
FT                   REVHRSGAPHPWEAELTTAELTLRLCGLVGLAGRARERWSELLAAEARLQELVSGTPSD
FT                   EVLTALLGDVDRPGPARAWELPPLTQLAAAAADREHLRGVADELRGDVARAEDALDATR
FT                   RLREEAMAALAEVERLREEATAEAAHLRRAVAKADEQLGDALMLVADAESERVGVEREL
FT                   AERSSRAEELAGENARLRTELDRLASSSVVRAGNRYLWPAARLVRGARDLALGRGGEEP
FT                   DRVLRGVGKVAPSAVPLLAGRVRRVSERDAGLRYQLSAPSEVPVGLGQVVDLDGWAVHD
FT                   DLPVRAVSVELGGRVLPATSGHPRPDVAAALGVHGWTGFRVRLPVRAGAVRPVLLVELA
FT                   DATVLRRELPELVGVPHEPEPVAVDWPGEGPRIAVCLATYNAPGGHFHEQVQSIKEQTH
FT                   SNWVCLISDDGSTDKAALRSATAGDPRFVVVEHAENVGFYRNFGRALAMVPVDADLVAL
FT                   SDQDDVWDADKLAVMAERFADPSVQLAYCDMRLVDGGGAVVAESAWTNRPNQWTDLEQL
FT                   LLLNTVTGAATVLRADLLRERVLPLPPGTPAAYHDQWIAATALAVGRIEFVDRALQSYR
FT                   QHGANVTGWQVPRLADGLPGLRGLAAAGAGVGHGVDLLEARQAELDHITEHELRRIAQF
FT                   STVLLMRNQDLLSERETAKLERLAGAERRLWPLVRLALEGEERPETAGAERRLLAAALL
FT                   RRHQQ"
     atggtcgagc agcccgtgta cgcggacggg gccgaggacg aggtgctgtc ccggctccgt        60
     cgcgctgcgg acgtctcggc cgggtcggcc gagctggccc gcgcactgcc gtcgtgggag       120
     ctgatctacc acttctcgcc ccagcgcacc gcgctgctcg cgccgatcga gctggtcgag       180
     ggcaccaggg tgctcgactt cggctgcggc tccggcgtgc tgaccagggc gatgggcgag       240
     ctgggcgcgg gcgtggtggg cgtcgagggg acgccgacgc gggccgaggc ggcgcgggag       300
     cgctgccggg acctgccgaa cgtgcggatc gtcgacggcg gcgccgagga gatcggcctg       360
     aacgggccgt tcgacctggc gctgctgtgc ggcgtcctgg agtactcgtc ggtgtacggc       420
     gacggtcccg aggcgctgct ggaggacgtg gtcggcgcgc tggagccggg cggcgcgctg       480
     gtgctggcga tcgagaacaa gatcggtctc ggctacctga ccggcaggcc cgaggaccac       540
     cacggcaagt cgtgggtcgg gctggcggac tacccgcgcg ggggcgcccg gacgtggccg       600
     cgcgcggagc tggccgagct gctggcgaac gcgggcctga cggcccagcg gtggatgctg       660
     ccgtacccgg actacaagct gccccgcgtg atcgtggacg ccgacgtgca cggccggggc       720
     gacgcggtcg acctggtcga caagctggtg cgcgacccgc tgtacggcgc gttcggcggc       780
     accaccggcg cggtgcccgg ccgctcgctg caccgcaccg cggtcgtgga gggcttcggg       840
     gcgtcggtgt cgccgtcgtt cctggtggtg gccgcgcgca cgcccgaggc ggtgcgccgg       900
     ttcgtccggc cgggtctggg ctggctggtg aactcggcgc ggctgccgcg gtggcggcgc       960
     tcgcgggtgc tcacgaccgc gctggagctg cgcgcggtcg agggcgcggg cgccgagtcg      1020
     gactggttgc gccaggaggc gcccgccgtc gagccgctgc tgccggggag gccgctggac      1080
     tcgctgctgc tggaggcgct ggcgcgcggc gacgaggagg agctgcgcgg gctgctcggg      1140
     ctgtggcggt cctgctgcga ggagggcgcg accgggctgg gcgaccagcc gaggcacccg      1200
     ttcctccctg gggcgcccgg cgtcccggtg ctggcggcga acgcgctcga cgtgcacccc      1260
     ggcaacgtgg tgctgctccc ggacggctcg ccgaggcgga tcgacctgga gtggtgcgcg      1320
     ggcgagggcg tcgacgccga gctggtgctg gtgcgggcgc tgctggagtt cgcccgcgag      1380
     gtgcaccgca gcggcgcgcc gcacccgtgg gaggccgagc tgaccacggc cgagctgacg      1440
     ctgcggctgt gcgggctggt cgggctggcc ggtcgggcgc gggagcgctg gtcggagctg      1500
     ctggccgccg aggcgcggtt gcaggagctg gtcagcggga cgccgtcgga cgaggtgctg      1560
     accgcgctgc tcggcgacgt ggaccggccg ggcccggcgc gggcctggga gctgccgccg      1620
     ctgacccagc tcgccgccgc ggcggcggac cgggagcacc tgcgcggggt ggccgacgag      1680
     ctgcgcggcg acgtggccag ggccgaggac gcgctggacg cgaccaggcg gctgcgcgag      1740
     gaggccatgg cggcgctcgc cgaggtcgag cggctccgcg aggaggcgac ggccgaggcc      1800
     gcgcacctgc ggcgggcggt ggcgaaggcg gacgagcagc tcggcgacgc gctgatgctg      1860
     gtcgcggacg ccgagtcgga gcgggtcggc gtggagcggg agctggccga gcggtcctcg      1920
     cgggccgagg agctggcggg cgagaacgcg cggctgcgga ccgagctgga ccggctggcg      1980
     tcgtcgagcg tcgtgcgggc gggcaaccgg tacctgtggc ccgccgcgcg gctggtgcgg      2040
     ggcgcgcggg acctggcgct gggccggggc ggcgaggagc cggaccgggt gctgcgcggg      2100
     gtcggcaagg tcgcgccgtc ggcggtgccg ctgctggccg ggcgggtgcg ccgggtgagc      2160
     gagcgggacg cggggctgcg ctaccagctg tccgcgccct ccgaggtgcc ggtcgggctg      2220
     ggccaggtcg tcgacctgga cggctgggcg gtgcacgacg acctgccggt gcgcgcggtg      2280
     tcggtggagc tgggcggccg ggtgctcccg gcgacctcgg gccacccgag gccggacgtg      2340
     gcggcggcgc tgggcgtgca cggctggacg ggcttccggg tccggctgcc ggtgcgggcc      2400
     ggcgcggtgc ggccggtgct gctggtggag ctggcggacg cgacggtgct gcgccgcgag      2460
     ctgcccgagc tggtgggcgt gccgcacgag ccggagccgg tcgcggtgga ctggccgggc      2520
     gagggccctc ggatcgcggt gtgcctggcg acgtacaacg cgccgggcgg gcacttccac      2580
     gagcaggtcc agtcgatcaa ggagcagacg cactcgaact gggtgtgcct gatcagcgac      2640
     gacgggtcga ccgacaaggc cgcgctgcgc agcgcgaccg ccggcgaccc ccggttcgtg      2700
     gtggtcgagc acgccgagaa cgtgggcttc taccggaact tcgggcgcgc gctggccatg      2760
     gtgccggtgg acgcggacct ggtggcgctg tccgaccagg acgacgtgtg ggacgcggac      2820
     aagctggccg tgatggcgga gcggttcgcc gacccgtccg tgcagctggc gtactgcgac      2880
     atgcggctgg tcgacggcgg cggcgcggtg gtggccgaga gcgcgtggac gaaccggccg      2940
     aaccagtgga ccgacctgga gcagctgctg ctgctgaaca cggtcaccgg cgcggcgacc      3000
     gtgctgcggg ccgacctgct gcgggagcgc gtgctgccgc tgccgccggg cacccccgcc      3060
     gcgtaccacg accagtggat cgcggcgacg gcgctggcgg tgggccggat cgagttcgtg      3120
     gaccgggcgc tccagtcgta ccggcagcac ggcgcgaacg tgaccggctg gcaggtgccg      3180
     aggctggccg acgggctgcc cggactgcgc gggctggccg cggcgggcgc gggcgtcggg      3240
     cacggcgtcg acctgctgga ggccaggcag gcggagctgg accacatcac ggagcacgag      3300
     ctgcggcgga tcgcgcagtt ctcgaccgtg ctgctgatgc gcaaccagga cctgctgagc      3360
     gagcgggaga ccgcgaagct ggagcggctg gcgggcgcgg agcggcggct gtggccgctg      3420
     gtgcggctgg cgctggaggg cgaggagcgg ccggagacgg cgggcgccga gcggcggctg      3480
     ctggcggcgg ccctgctgcg caggcaccag cagtag                                3516
//

If you have problems or comments...

PBIL Back to PBIL home page