(data stored in ACNUC7421 zone)

EMBL: CP001630.PE550

CP001630.PE550       Location/Qualifiers
FT   CDS_pept        complement(602010..602867)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0557"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: bcj:BCAS0321a hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0557"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34524"
FT                   /db_xref="UniProtKB/TrEMBL:C6WJ92"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACU34524.1"
FT                   /translation="MVATPDTLHDFVLDLLSNPSALAAFQVDAEGCLAAAGLSDVTALD
FT                   VQEVIPLVLDFAPSAGLPALDGIVAGDLDLDLEGSVSAIAQLQAVTQQLTGVVGAGSDL
FT                   NLGAVGALTADASGVGLLGGNGDLGLGLGADVATSVDATVATSFSAVGDVTATLDGATT
FT                   AVTQTAAGVDTTVDATLSGAVDTLDGTVGSALPGLDGVTSPLFDTVGSVHGSVSAVADQ
FT                   AFGALGGGGLDLGATLEPVGDLTQHVTATVSATAHNAGVGGVTDAVGHATAPIAESPLG
FT                   DLLF"
     atggtcgcca ccccggacac gctgcacgac ttcgtcctcg acctgctgag caacccgagc        60
     gccctggccg ccttccaggt cgacgccgag ggctgcctgg ccgccgccgg cctgagcgac       120
     gtcaccgcgc tggacgtcca ggaggtcatc ccgctggtgc tcgacttcgc gccgtccgcc       180
     ggcctgcccg ccctggacgg gatcgtcgcg ggtgacctgg acctcgacct ggagggctcc       240
     gtctcggcga tcgcccagct gcaggccgtg acccagcagc tgaccggcgt ggtcggcgcg       300
     ggctcggacc tcaacctggg cgccgtgggc gcgctcaccg ccgacgccag cggcgtgggc       360
     ctgctcggcg gcaacggcga cctgggtctc ggtctgggcg ccgacgtggc gacgagcgtg       420
     gacgccaccg tggcgaccag cttctccgcg gtgggcgacg tgaccgccac cctggacggc       480
     gcgaccaccg ccgtcaccca gaccgccgcc ggtgtggaca ccacggtcga cgccaccctg       540
     tcgggcgcgg tggacaccct cgacgggacc gtcggctcgg ccctgccggg tctggacggc       600
     gtgacctccc cgctgttcga caccgtgggc tcggtgcacg gctccgtcag cgccgtggcc       660
     gaccaggcgt tcggcgcgct cggcggcggt ggcctggacc tgggcgcgac cctggagccg       720
     gtcggcgacc tcacccagca cgtcaccgcg accgtctccg ccaccgcgca caacgcgggt       780
     gtgggcggcg tcacggacgc ggtgggccac gcgaccgcgc cgatcgccga gtcccccctc       840
     ggcgacctgc tgttctga                                                     858
//

If you have problems or comments...

PBIL Back to PBIL home page