(data stored in ACNUC7421 zone)

EMBL: CP001630.PE551

CP001630.PE551       Location/Qualifiers
FT   CDS_pept        603113..604432
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0558"
FT                   /product="molecular chaperone-like protein"
FT                   /note="KEGG: hha:Hhal_0145 heat shock protein 70"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0558"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34525"
FT                   /db_xref="InterPro:IPR013126"
FT                   /db_xref="UniProtKB/TrEMBL:C6WJ93"
FT                   /inference="protein motif:COG:COG0443"
FT                   /protein_id="ACU34525.1"
FT                   /translation="MSYVLGVDAGSTRTSAAVCHLGGAGRSEAEVVGLGGPGGGVATCL
FT                   QLTADGDFAVGEPGDPRWTASDFVRRVGDDVPVVLGADPCTPQELVGLLVAHVARRVAE
FT                   REGEPPAHVVLSHPPGWGPHARALVHAALRDAGLARVTLLPEPLAVAADHAENHRGRTG
FT                   LLAVLGVGSHATTSALVRLAPNGEHELLAWSEEADRWAGADLDDLVFAHVAAELGGLDP
FT                   AQPHLLPAVARLRRDCESAKRVLSGVPVTAVPVHLPDGRVDVELTRERFEELARPGVEL
FT                   AVRGLERLCRGHRPDAIALVGGTARTPLLASAVTAAVPGRLVLAAAPETCAVRGAALAG
FT                   RRLLLGPDTGPDHGETSVLVHGDDPSLRFPVGQLAWDDAESAAPPPRPPVEITPLDLPT
FT                   PLSVKRVVRRGLAPIGRSRRRGGRSEPDPRHRTRHDEDGR"
     ttgtcgtacg tcctcggggt cgacgcgggc tccacccgca cctcggccgc cgtctgccac        60
     ctcggcggcg cgggccgctc cgaagccgag gtcgtcggcc tcggcggacc gggtggcggc       120
     gtcgccacct gcctgcagct gaccgccgac ggcgacttcg cggtcggcga gccgggtgac       180
     ccgcgctgga ccgcgtcgga cttcgtccgc cgggtcggcg acgacgtccc cgtcgtcctg       240
     ggcgcggacc cgtgcacccc ccaggagctg gtcgggctgc tcgtcgccca cgtcgcccgg       300
     cgcgtggccg agcgcgaggg cgagccgccc gcgcacgtcg tgctgtccca cccgccgggc       360
     tggggaccgc acgccagggc gctggtccac gcggccctgc gcgacgccgg gctcgcgcgg       420
     gtcaccctgc tcccggaacc gctggccgtc gccgccgacc acgccgagaa ccaccggggc       480
     cgcaccggcc tgctcgcggt cctgggcgtg ggcagccacg ccaccacctc cgcgctggtc       540
     cgcctcgccc cgaacggcga gcacgagctg ctcgcctggt ccgaggaggc cgaccggtgg       600
     gcgggcgccg acctggacga cctggtcttc gcgcacgtcg ccgccgagct cggcggcctc       660
     gacccggcgc agccgcacct gctgcccgcc gtcgccaggc tgcgccggga ctgcgagtcc       720
     gccaagcgcg tcctgtccgg cgtgcccgtc acggccgtgc cggtgcacct gccggacggc       780
     cgcgtcgacg tcgagctgac cagggagcgc ttcgaggagc tggccaggcc cggcgtcgag       840
     ctggccgtgc gcggcctgga gcggctgtgc cgcggccacc gccccgacgc gatcgccctg       900
     gtcggcggca cggccaggac gccgctgctg gcctccgccg tcaccgccgc cgtgcccggc       960
     aggctcgtgc tggccgccgc ccccgagacc tgcgcggtcc ggggcgccgc cctcgcgggc      1020
     aggcggctgc tcctgggccc ggacaccgga cccgaccacg gcgagacctc cgtgctcgtg      1080
     cacggggacg acccgtcgct gcgcttcccc gtcggccagc tcgcctggga cgacgcggag      1140
     agcgccgcgc ccccgccgcg ccccccggtc gagatcaccc cgctcgacct gcccaccccc      1200
     ctgtcggtga agcgggtcgt gcgccgcggc ctcgccccga tcggccgctc ccgccgccgc      1260
     ggcggccggt ccgagcccga cccccgacac cgcacccgac acgacgagga cggccgttga      1320
//

If you have problems or comments...

PBIL Back to PBIL home page