(data stored in ACNUC7421 zone)

EMBL: CP001630.PE552

CP001630.PE552       Location/Qualifiers
FT   CDS_pept        604441..606807
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0559"
FT                   /product="transcriptional regulator, LuxR family"
FT                   /note="PFAM: regulatory protein LuxR; Sigma-70 region 4
FT                   type 2; SMART: regulatory protein LuxR; KEGG:
FT                   ank:AnaeK_3854 tetratricopeptide TPR_2 repeat protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0559"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34526"
FT                   /db_xref="GOA:C6WJ94"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:C6WJ94"
FT                   /inference="protein motif:PFAM:PF00196"
FT                   /protein_id="ACU34526.1"
FT                   /translation="MTTPPKPVLDTAARALLDEIAANPGAVLRLGVLAPGGHGKTTLLR
FT                   EVERALAQNGADVTAVDDAHLLGDDELRALRALVERGDTSVVVAYRPWPRSRALAALAE
FT                   SLGRVRPAHLPAPLTREQVRHALPPSTGRALVDFVHQQTGGVPRFVARLSGLTSPELTP
FT                   DVIASFRADLDWLDPDAQKFLLAAEAGAALRLDLLRSLLGGDADRVADVIDAARATGLL
FT                   APDGTLLPVARTAVAALSRTDRRIAVRRALAESQLRAGGPVLDLVRPLLTAPGPELSEL
FT                   FKAAAAEALPSDPALAARLLAAIGTPTPEVAVRHATASAMAGDLDSALRLADRVVAAGD
FT                   QTHRGAAAEVAAIALAHRGQLARSTELHRWSPSATSTAFAHIGQIGVGALPAAPLPPAP
FT                   PTLLGGAASLMAHGVLESVTGSPTTALSTLVRASGLLEPAGAGVLLPDSPAALAALVAL
FT                   HSGEPVVAESALDRAVASGLGGSLMAVRHRLLRAWIAMGRGNLERARETITALRRANRP
FT                   LEPRDWIFAVALEIGIARRNSDLPTLKRTWEQACEAVLRHPVDLYTFLPLGEFAAAAAR
FT                   LRDQHRLAPHLAAAEDLLRGLGNPALWAVPLHWSGLHAAVIAEEIPAAEEHAAALAAHR
FT                   DSGRYCAIVSSAAESWLDVLAGKVDPDQVERAARGLHAAGQWWDAARLAGQAAIRTSDR
FT                   QAMVRLLDCARLLQGRPLGGRKPVEPETGQETGKLSDREREVAELVVGGLTYKQVGDRL
FT                   FISAKTVEHHVARIRQRLGCTSRAELLDQLRQIVG"
     atgacgactc cccccaagcc cgtcctggac accgcggccc gcgccctgct cgacgagatc        60
     gccgcgaacc ccggcgcggt cctgcgcctc ggcgtgctcg cgcccggcgg gcacgggaag       120
     accaccctgc tgcgcgaggt cgagcgggcc ctcgcgcaga acggcgccga cgtcaccgcc       180
     gtggacgacg cgcacctgct cggcgacgac gagctgcgcg ccctgcgcgc cctggtcgag       240
     cgcggcgaca cctccgtcgt cgtcgcctac cggccgtggc cgcgctcccg cgcgctggcc       300
     gccctcgccg agtccctcgg ccgcgtccgc cccgcccacc tgcccgcccc gctcacccgc       360
     gagcaggtca ggcacgccct gcccccgtcc accggccgcg ccctggtcga cttcgtccac       420
     cagcagaccg gcggcgtgcc ccgcttcgtc gcccggctct ccgggctgac ctcgccggag       480
     ctgaccccgg acgtcatcgc ctccttccgc gccgacctgg actggctcga cccggacgcc       540
     cagaagttcc tcctcgccgc cgaggccggg gccgccctgc gcctggacct gctgcgctcg       600
     ctgctcggcg gggacgccga ccgggtcgcc gacgtcatcg acgccgcccg cgccaccggc       660
     ctgctcgccc ccgacggcac cctgctgccg gtggcccgca ccgccgtggc cgccctcagc       720
     cgcaccgacc ggcgcatcgc cgtgcgccgc gcgctggccg agtcccagct gcgcgcgggc       780
     ggccccgtgc tcgacctggt ccggccgctg ctcaccgccc ccggcccgga gctgtccgag       840
     ctgttcaagg ccgccgccgc cgaggccctg cccagcgacc cggcgctcgc cgcccggctg       900
     ctcgccgcca tcggcacccc cacccccgag gtggccgtcc ggcacgccac cgcctccgcc       960
     atggcgggcg acctggactc cgcgctgcgc ctggccgacc gggtcgtcgc ggcgggcgac      1020
     cagacccacc ggggcgccgc cgccgaggtc gcggccatcg cgctcgccca ccgcggccag      1080
     ctcgcccgca gcaccgagct gcaccgctgg tcgcccagcg ccacctccac cgcgttcgcg      1140
     cacatcggcc agatcggcgt cggcgcgctc ccggccgcgc cgctgccgcc cgccccgccc      1200
     accctgctcg gcggagccgc ctcgctgatg gcgcacggtg tcctcgaatc ggtcaccggc      1260
     agccccacca ccgcgctgtc caccctggtc agggcctcgg gactgctgga accggcgggc      1320
     gcgggcgtgc tgctgcccga ctcgcccgcc gccctcgccg cgctggtcgc gctgcacagc      1380
     ggcgagccgg tggtcgccga gtccgcgctc gaccgcgccg tcgcctccgg cctcggcggc      1440
     tcgctcatgg ccgtgcggca ccggctgctg cgcgcctgga tcgccatggg ccggggcaac      1500
     ctggagcgcg cccgcgagac gatcaccgcg ctgcgcaggg cgaaccggcc cctggaaccc      1560
     cgcgactgga tcttcgcggt ggcgctggag atcggcatcg cccgccgcaa cagcgacctg      1620
     cccaccctca agcgcacttg ggagcaggcc tgcgaggcgg tgctgcgcca ccccgtcgac      1680
     ctgtacacgt tcctgccgct gggcgagttc gccgcagccg ccgcccggct gcgcgaccag      1740
     caccgcctcg ccccgcacct ggccgccgcc gaggacctgc tgcgcggcct cggcaacccc      1800
     gcgctgtggg cggtgccgct gcactggagc ggcctgcacg ccgccgtcat cgccgaggag      1860
     atcccggccg ccgaggagca cgccgccgcg ctcgccgccc accgcgactc gggccgctac      1920
     tgcgcgatcg tctccagcgc cgccgagagc tggctcgacg tgctcgcggg caaggtcgac      1980
     cccgaccagg tcgagcgggc cgcgcgcggg ctgcacgcgg cgggccagtg gtgggacgcc      2040
     gcccgcctcg cgggccaggc cgccatccgc acctccgacc ggcaggccat ggtccggctg      2100
     ctcgactgcg cgcggctgct ccagggcagg ccgctgggcg ggcgcaagcc ggtcgagccc      2160
     gagaccgggc aggagaccgg caagctcagc gaccgcgagc gcgaggtcgc cgagctggtc      2220
     gtcggcgggc tcacctacaa gcaggtgggc gaccggctgt tcatctccgc caagaccgtc      2280
     gagcaccacg tggcccgcat caggcagcgc ctgggctgca ccagccgcgc ggagctgctc      2340
     gaccagctcc gccagatcgt cggctga                                          2367
//

If you have problems or comments...

PBIL Back to PBIL home page