(data stored in ACNUC7421 zone)

EMBL: CP001630.PE553

CP001630.PE553       Location/Qualifiers
FT   CDS_pept        complement(607000..607530)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0560"
FT                   /product="small integral membrane protein"
FT                   /note="KEGG: hch:HCH_05440 small integral membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0560"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34527"
FT                   /db_xref="GOA:C6WJ95"
FT                   /db_xref="InterPro:IPR018681"
FT                   /db_xref="UniProtKB/TrEMBL:C6WJ95"
FT                   /inference="similar to AA sequence:KEGG:HCH_05440"
FT                   /protein_id="ACU34527.1"
FT                   /translation="MRFLARVGGPRAAVVVLTAVAGVYMALVAFNNVTDYGSNHAFVQH
FT                   VFAMDTTFGAPSAAWRAITSPALVTVAYVLIIAWEALTAVVLLVGLGAWLSGRSRLGSL
FT                   LSGTGFGMQVLLFGLGFIVIGGEWFLMWQSKQWNGLAPALQNVVIAGFGLVLVHVAGRG
FT                   EPVVERADAGRAG"
     atgcgctttc tggctcgggt cgggggaccc cgcgcggcgg tcgtggtgct caccgccgtc        60
     gccggcgtct acatggcact ggtggcgttc aacaacgtca ccgactacgg gtccaaccac       120
     gcgttcgtgc agcacgtgtt cgcgatggac accacgttcg gcgcgccgag cgcggcgtgg       180
     cgggcgatca cgagcccggc gctggtgacg gtcgcgtacg tgctgatcat cgcctgggag       240
     gcgctgacgg cggtggtgct gctggtgggg ctgggggcgt ggctgtccgg ccggtcgcgg       300
     ctggggtcgc tgctgtccgg gaccgggttc gggatgcagg tgctgctgtt cgggctgggg       360
     ttcatcgtga tcggcggcga gtggttcctg atgtggcagt cgaagcagtg gaacgggctg       420
     gcccccgcgc tgcagaacgt ggtgatcgcc gggttcgggc tggtgctggt gcacgtggcc       480
     gggcggggcg agccggtggt ggagcgcgcc gacgcggggc gcgcgggctg a                531
//

If you have problems or comments...

PBIL Back to PBIL home page