(data stored in ACNUC7421 zone)

EMBL: CP001630.PE554

CP001630.PE554       Location/Qualifiers
FT   CDS_pept        complement(607655..611689)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0561"
FT                   /product="WD-40 repeat protein"
FT                   /note="PFAM: WD-40 repeat protein; SMART: WD-40 repeat
FT                   protein; KEGG: scl:sce4551 protein kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0561"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34528"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR011047"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR017986"
FT                   /db_xref="InterPro:IPR019775"
FT                   /db_xref="InterPro:IPR020472"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036322"
FT                   /db_xref="InterPro:IPR041664"
FT                   /db_xref="UniProtKB/TrEMBL:C6WJ96"
FT                   /inference="protein motif:PFAM:PF00400"
FT                   /protein_id="ACU34528.1"
FT                   /translation="MVGNGHGSGPRTAFAERFALLYAEAGDPPLKRVTASVARSRRVDE
FT                   QGRPVRVTAQRVSDWRRGRNVPARFSALSVVLEVLIGEARKQRPTPPIPELHDLEAWRE
FT                   LWEQALASPVAAVESGPAEMPEESGVCPYRGLAAFQPEDSSWFFGRERSTAALVTRLDN
FT                   STEYGGIVVLVGASGAGKSSLVRAGLIPSIREGALADPSSATWPSAVMTPGAKPLAELV
FT                   ERVPELSAVLPPGGLPDDPPTERGAGPRSLGVIDFAERVRAAVAEHARARGGERLVLVV
FT                   DQFEEAFTLCGDDAQVQLFVQALAAACTPERPGGHAPALVVLGVRADFYGRCLAIPELA
FT                   DALQERQMVLGPMTSAELREAVARPARAAGLQLEAGLVELMLRDLGVRAGRTPVHGARG
FT                   AYDAGALPLLSHALLATWQRRQAGRLTIAGYRAAGGIQGAVAATAERAWADLPPAAQGA
FT                   ARPLLLRLVRIGADTHDTRRRSTRQELVGQAGDPAAAEEALEVLARARLVTLDAGSVEI
FT                   THEALIQAWPRLRGWIDQDREGELLRQRLEEDAAAWAEQGRDSSLLYRGARLEAARHWA
FT                   TRHRADGAGPTGATGDFLAVSGQHHRRGVWALRGGAALVVVLALIAGVAAVVAVRQRDD
FT                   AVFRQVVAEADKLLDRDPSLSAQLALVARGMRPSALDLGTRLISSGGAPLATPLTGHTG
FT                   AVYLTTFSPDGRTLATASYDRTVRLWDVTDRDDPKPLGEPLTGHGDWVSSAVFSPDGRT
FT                   LASAGKDGSVRLWDVADRARPRQLSTAESPGRDTVYLVAFSPDGRTLASAHADRAVRLW
FT                   DVTDPSAPKQVAELAGHGQQVRTVAFSPTGLLASGSDDATVRLWDVADPSAPRQAGEPL
FT                   GGFDSTVHSVAFSPDGRTLAAGSEDRSIRLWDVTDPAAPEARGRPLALHLAPVWSVAFS
FT                   PDGRVLASGAADSTARLWNVTDPARVQPLGKPLAGRSGTVFAVGFSPDGRALATGSLDP
FT                   VVRMWSLPSTVLVGHAARTVGPRFAPDGRALLTGSEDGTVRAWDLAGPGGPDAPTPIGD
FT                   RRDAGEPVRAVVLGEDGRTMVTAGPKAVRLWDVRPGAEPEPLGEPLPLRTRFSSPLALR
FT                   GNLLVTADEDDTVLLWDLSDRARPRQLGEPLTGHDGYVNVALLTPDGRFLVTGSADSAL
FT                   RVWDVSDPARPRAAGRFPGHDGPVRAGALSPDGRVLATAGDDKLVRLWDFSDPTAPRAL
FT                   GAPLAGHEEAVVAVVFTPDGRTLASGGEDARLRLWDTSAPALARPIGEGVVGHDSALRD
FT                   ISVSPDGSVVATSSADGTVRLWHLDADWARRRICARTGGVLTEDAWREHVPQLDYAPPC
FT                   R"
     atggtgggga acggtcacgg ttcgggtcct cgcaccgctt tcgccgaacg cttcgcgctg        60
     ctctacgcgg aggcgggcga ccccccgctc aagcgcgtga ccgcctcggt ggccaggtcc       120
     cgccgggtcg acgagcaggg ccgaccggtg cgggtgaccg cgcagcgggt gagcgactgg       180
     cgccgggggc gcaacgtccc ggcccggttc tcggcactct cggtagtgct ggaggtgctc       240
     atcggtgaag ccaggaagca gcggccgacc ccgccgatcc ccgagctgca cgacctggag       300
     gcgtggcgcg agctgtggga gcaggccctc gccagccccg tcgcggccgt cgagagcggg       360
     cccgcggaaa tgcccgagga aagcggcgtg tgcccctacc ggggattggc cgccttccag       420
     cccgaggatt cctcctggtt cttcggccgg gaacgcagca cggccgccct cgtcacccgg       480
     ctggacaatt ccacggaata cggcggaatc gttgtcctgg tcggcgcctc gggcgccggg       540
     aaatcctcgc tggtgcgcgc cggcctcatt ccctccatcc gcgagggggc gttagccgac       600
     ccgagctccg cgacctggcc ctcggccgtc atgacaccgg gcgcgaaacc gctcgccgaa       660
     ttggtcgagc gggttcccga gctgtccgcg gtcctgcccc ccggcgggct ccccgacgac       720
     ccgccgaccg agcgcggcgc gggcccgagg tcgctgggcg tgatcgactt cgcggaacgg       780
     gtcagggccg ctgtcgccga gcacgcgcgg gcgcgcggcg gcgagcgcct ggtgctggtg       840
     gtcgaccagt tcgaggaggc cttcaccctc tgcggcgacg acgcgcaggt ccagctgttc       900
     gtccaggcgc tggcggcggc ctgcaccccg gagcggccgg gcgggcacgc gcccgcgctg       960
     gtcgtgctgg gcgtgcgcgc cgacttctac gggcgctgcc tggcgatccc ggagctggcc      1020
     gacgcgctcc aggagcggca gatggtcctg ggcccgatga cctcggccga gctgcgcgag      1080
     gcggtggcca ggcccgcgcg cgcggccggg ctccagctgg aggccggcct ggtcgagctg      1140
     atgctgcgcg acctgggcgt gcgggccggt cggacgccgg tgcacggcgc gcggggcgcg      1200
     tacgacgcgg gcgccctgcc gctgctctcg cacgccctgc tcgccacctg gcagcgcagg      1260
     caggcgggca ggctcaccat cgcggggtac cgggcggcgg gcggcatcca gggcgcggtg      1320
     gccgccacgg ccgagcgcgc ctgggccgac ctgcccccgg ccgcgcaggg cgccgcgcgc      1380
     ccgctgctgc tgcgcctggt gcggatcggc gcggacaccc acgacacccg ccgccgctcc      1440
     acccggcagg agctggtggg ccaggcgggc gacccggccg ccgccgagga ggccctggag      1500
     gtgctggccc gcgcccggct ggtcaccctc gacgcgggct cggtggagat cacccacgag      1560
     gcgctgatcc aggcgtggcc gaggctgcgc ggctggatcg accaggaccg ggagggcgag      1620
     ctgctgcggc agcggctgga ggaggacgcg gcggcctggg ccgagcaggg ccgggactcc      1680
     tcgctgctgt accggggcgc gcggctggag gcggccaggc actgggcgac caggcaccgg      1740
     gcggacggcg cgggcccgac cggcgccacc ggcgacttcc tcgcggtgtc cggccagcac      1800
     caccggcgcg gggtgtgggc gctgcgcggc ggggccgcgc tggtggtggt gctcgcgctg      1860
     atcgccgggg tcgcggccgt ggtggcggtg cgccagcgcg acgacgcggt gttccggcag      1920
     gtcgtggccg aggccgacaa gctgctcgac cgcgacccgt cgctgtccgc gcagctggcg      1980
     ctggtcgcgc gcgggatgcg gccgtccgcg ctcgacctgg gcacccggct gatctcctcc      2040
     ggcggcgcgc cgctggccac cccgctgacc gggcacaccg gcgcggtcta cctgaccacg      2100
     ttctccccgg acggccgcac cctggccacc gccagctacg accgcaccgt gcggctgtgg      2160
     gacgtcaccg accgggacga cccgaaaccg ctgggcgagc cgctgaccgg gcacggcgac      2220
     tgggtcagct ccgccgtgtt ctcccccgac ggccgcacgc tcgcgtcggc gggcaaggac      2280
     ggctcggtcc ggctgtggga cgtcgccgac cgggcgcgcc ccaggcagct gagcaccgcg      2340
     gagtcccccg gcagggacac cgtctacctg gtcgcgttct ccccggacgg ccgcacgctc      2400
     gcgtccgcgc acgccgaccg cgcggtgcgg ctgtgggacg tcaccgaccc gagcgccccg      2460
     aagcaggtcg cggagctggc cgggcacggg cagcaggtgc gcaccgtggc cttctccccc      2520
     accgggctgc tggcctccgg ctcggacgac gcgaccgtgc ggctgtggga cgtggcggac      2580
     ccgagcgcgc cgaggcaggc cggggagccg ctgggcgggt tcgacagcac ggtgcactcg      2640
     gtcgcgttct cccccgacgg ccgcaccctc gccgcgggca gcgaggaccg cagcatccgg      2700
     ctgtgggacg tcaccgaccc ggccgccccc gaggcgcgcg gcaggccgct ggcgctgcac      2760
     ctggccccgg tgtggtcggt cgcgttctcc ccggacgggc gggtgctggc ctcgggcgcg      2820
     gcggacagca cggcgcggct gtggaacgtc accgacccgg cgcgggtcca gccgctgggc      2880
     aagccgctgg cgggccgcag cggcacggtg ttcgcggtcg ggttctcccc cgacggccgc      2940
     gcgctggcca ccggcagcct ggacccggtg gtgcggatgt ggtcgctgcc gtcgacggtg      3000
     ctggtcgggc acgccgcccg cacggtcggc ccccggttcg ccccggacgg gcgcgcgctg      3060
     ctgaccggca gcgaggacgg cacggtgcgc gcgtgggacc tggccggtcc cggcggcccg      3120
     gacgcgccca ccccgatcgg cgaccggcgg gacgcgggcg agccggtgcg ggcggtggtg      3180
     ctgggcgagg acggccgcac gatggtcacg gcgggcccga aggcggtgcg gctgtgggac      3240
     gtgcggccgg gcgcggagcc ggaaccgctg ggcgagccgc tgccgctgcg cacccggttc      3300
     agctcgccgc tggcgctgcg cgggaacctg ctggtcacgg cggacgagga cgacaccgtc      3360
     ctgctgtggg acctgtccga ccgggcgcgc cccaggcagc tgggcgagcc gctgaccggg      3420
     cacgacgggt acgtgaacgt cgcgctgctc accccggacg gccggttcct ggtgaccggc      3480
     agcgccgaca gcgcgctgcg ggtgtgggac gtgtcggacc cggcgcgccc gagggcggcg      3540
     ggccggttcc ccggccacga cggcccggtg cgggcgggcg cgctgtcccc ggacgggcgg      3600
     gtgctggcga cggcgggcga cgacaagctg gtgcggctgt gggacttctc ggacccgacc      3660
     gcgccgaggg cgctgggagc gccgctggcc gggcacgagg aggccgtggt ggcggtggtg      3720
     ttcacccccg acgggcgcac cctggccagc ggcggcgagg acgcgcggct gcggctgtgg      3780
     gacacctcgg cccccgcgct ggcccggccg atcggcgagg gcgtggtcgg gcacgactcg      3840
     gcgctgcggg acatctcggt gagcccggac ggctcggtgg tggcgaccag ctcggccgac      3900
     ggcacggtgc ggctgtggca cctggacgcg gactgggccc gcaggcggat ctgcgcgcgg      3960
     accgggggcg tgctgaccga ggacgcctgg cgggagcacg tcccgcagct ggactacgcg      4020
     cccccgtgca ggtag                                                       4035
//

If you have problems or comments...

PBIL Back to PBIL home page