(data stored in ACNUC7421 zone)

EMBL: CP001630.PE555

CP001630.PE555       Location/Qualifiers
FT   CDS_pept        complement(612309..612665)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0562"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: similar to zinc finger protein 607"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0562"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34529"
FT                   /db_xref="UniProtKB/TrEMBL:C6WJ97"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACU34529.1"
FT                   /translation="MGRVGPVGCGSAGRPASAAWIVASFAVPVLPVPPSAPRPPPRRPR
FT                   ARVRARVRTRARLVVVRFPRAVGTGGRRFGELVRPIVRRVIRAGPGPGCGRRPAMGVGA
FT                   RSGEVPTTVSQVVW"
     gtgggacgcg tgggtccggt ggggtgtggt tctgcgggtc gtccggcctc tgcggcgtgg        60
     atcgtggcgt cgttcgccgt cccggttctc ccggttccgc cctcagcacc tcggccccct       120
     ccccggcgcc cccgcgcccg tgtccgcgcc cgtgtccgaa cccgtgcccg gctggtcgtc       180
     gtgcggttcc cgcgagcggt cggaacgggt ggccggcggt tcggggaact ggtgcgcccg       240
     atcgttcggc gcgtcatccg cgccgggccc ggtccggggt gcggaaggcg ccccgcaatg       300
     ggggtggggg cgcggtccgg tgaagtgccg accacggtta gccaggtggt ctggtga          357
//

If you have problems or comments...

PBIL Back to PBIL home page