(data stored in ACNUC7421 zone)

EMBL: CP001630.PE556

CP001630.PE556       Location/Qualifiers
FT   CDS_pept        612716..614470
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0563"
FT                   /product="transcriptional regulator, AraC family"
FT                   /note="PFAM: AlkA domain protein; helix-turn-helix- domain
FT                   containing protein AraC type; SMART: helix-turn-helix-
FT                   domain containing protein AraC type; KEGG: scl:sce6205
FT                   putative regulatory protein Ada"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0563"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34530"
FT                   /db_xref="GOA:C6WJ98"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR010316"
FT                   /db_xref="InterPro:IPR011257"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR018062"
FT                   /db_xref="InterPro:IPR023170"
FT                   /db_xref="InterPro:IPR037046"
FT                   /db_xref="UniProtKB/TrEMBL:C6WJ98"
FT                   /inference="protein motif:PFAM:PF06029"
FT                   /protein_id="ACU34530.1"
FT                   /translation="MGAHAPADRHTTTHPPATDRPPATTGRATRGGAPTADRAPIGSRI
FT                   PTAGQPAAASRVPADASAPTTSRAATSHAGANAVAPAAGRTPVGRASADAGGPTAGRGA
FT                   AGRVPAAAGAPAASHAAASRASAGAGAPAAGRAAPGPAPAEVGAPATGHTTAPRPRAPH
FT                   PFADHPTAPPTTDLVDPTWGPRSDPVARALRMIVDGVVDREGVPGLATRLGYSVRQVER
FT                   RLLAELGSGPLAIARARRARTARLLAETTALPMTEIAVAAGFASVRAFNETVRELFGRS
FT                   PTDLRGGRRAPGGVPGAVVLRLPFRGPLHAPSLFGPLVANAVPGVEEWRDGAYRRTLRL
FT                   PRGHGVVSLRPRADHVECDLTLTDSRDLPVAISRCRRALDLDADPAEVDGALRADPALR
FT                   PLVDAAPGTRVPGVVDGAECAVRALLGEGTGTGAAMGAGANAGWAHRVVREAGEAVPDP
FT                   AGGGLTHLFPTPQALLDLDPALLPPPARAPLTALLTALVGGVDLGAGADRAEARSALRC
FT                   AGERVLDAVLTRSLGDPDGFCPDDPAVRAAAGGIGLPVTAAALADRSRAWRPWRAYATR
FT                   YLLGRAPT"
     gtgggcgccc acgcgcccgc cgaccgccac accaccaccc acccgcccgc caccgatcgc        60
     ccgcccgcca ccaccggcag ggccacccgc ggcggcgctc ccaccgccga ccgcgccccg       120
     atcggcagcc ggattccgac cgctggtcag cccgcggcgg ccagccgtgt ccccgccgac       180
     gccagcgccc ccaccaccag ccgtgctgcc accagccacg ccggggccaa cgcggttgct       240
     cctgccgctg gccgcacccc cgttggtcgt gcctcggcgg acgccggtgg tccgaccgcc       300
     ggtcgtggtg ccgctggtcg cgtcccggcc gctgctggcg cgcctgccgc cagccacgcc       360
     gccgccagcc gtgcctcggc cggtgcgggt gctcccgccg ccggccgtgc tgcccccggc       420
     cccgccccag ccgaagtcgg cgcgcccgcc accggccaca ccaccgcccc ccgcccccgc       480
     gccccccacc ccttcgccga ccaccccacc gccccaccca ccaccgacct ggtcgacccc       540
     acctggggcc ccaggtccga cccggtggcc cgggcgctgc gcatgatcgt cgacggcgtg       600
     gtcgaccgcg agggcgtgcc cggtctcgcc acccggctcg gctacagcgt ccgccaggtc       660
     gagcgccgcc tcctggccga gctgggctcc ggcccgctcg ccatcgcccg cgcccgccgc       720
     gcgcgcaccg cccgcctcct ggccgagacc accgccctcc ccatgaccga gatcgccgtg       780
     gcggcgggct tcgcgagcgt gcgcgcgttc aacgagacgg tgcgcgagct gttcggccgc       840
     tcgcccaccg acctgcgcgg cggtcgccgg gctcccggcg gcgtgccggg cgcggtcgtg       900
     ctgcggttgc cgttccgggg gccgctgcac gcgccgtcgc tgttcgggcc gctggtcgcg       960
     aacgccgtcc ccggcgtcga ggagtggcgc gacggcgcct accgccgcac gctgcgcctc      1020
     ccgcgcggcc acggcgtggt ctcgctgcgc ccgcgcgccg accacgtcga gtgcgacctg      1080
     accctcaccg actcccgcga cctcccggtc gcgatctccc gctgccgccg cgcgctggac      1140
     ctggacgccg accccgccga ggtcgacggc gccctccgcg cggaccccgc cctgcgcccg      1200
     ctggtcgacg ccgcgccggg caccagggtc cccggcgtgg tcgacggcgc ggagtgcgcg      1260
     gtgcgcgccc tgctcggcga aggcacgggc acgggcgcag ccatgggcgc gggcgccaac      1320
     gcgggctggg cgcaccgggt ggtgcgcgag gcgggcgagg ccgtccccga cccggcgggc      1380
     ggcggcctga cccacctctt cccgacgccg caagcgctcc tggacctgga cccggccctg      1440
     ctccccccac cggcgcgcgc cccgctcacc gccctgctca ccgcgctggt gggcggcgtc      1500
     gacctgggcg cgggcgcgga ccgcgccgag gcccggtcgg cgctgcgctg cgcgggcgag      1560
     cgcgtgctgg acgccgtcct cacccgctcg ctgggcgacc cggacggctt ctgccccgac      1620
     gaccccgccg tgcgcgccgc cgcgggcggg atcggcctgc cggtcaccgc cgccgcgctg      1680
     gccgaccgct cgcgcgcgtg gcgcccgtgg cgcgcctacg cgacccgcta cctgctgggc      1740
     cgcgccccga cctga                                                       1755
//

If you have problems or comments...

PBIL Back to PBIL home page