(data stored in ACNUC7421 zone)

EMBL: CP001630.PE558

CP001630.PE558       Location/Qualifiers
FT   CDS_pept        complement(614904..615737)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0565"
FT                   /product="protein of unknown function DUF574"
FT                   /note="PFAM: protein of unknown function DUF574; KEGG:
FT                   scl:sce6070 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0565"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34532"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:C6WJA0"
FT                   /inference="protein motif:PFAM:PF04672"
FT                   /protein_id="ACU34532.1"
FT                   /translation="MPALSPDAPAPVYIDTTKASIARVYDAFLNGKDNYEIDREVLRRV
FT                   QQVTPEAATLAVDNRGFLIRATRFLASQTGITQYLDCGSGLPTAENTHQVVQRLQPEAR
FT                   VVYVDNDPVVLAHGRALLEENDQTHFSAADIFDPEAILDDPVVREHIDFSKPVALLQLG
FT                   TMHHHNGTSPTSREIMAKYVDALPSGSFVALSHFLDPETEELSRLARRMEQAFLHSPMG
FT                   SGKFITRAELLGLFDGLELVEPGLVICADWWPDGPQLKELAPVSRCIAGAVGWKR"
     atgcccgctc tgtcgccgga cgcccccgcc ccggtctaca tcgacacgac caaggcgagc        60
     atcgccaggg tctacgacgc gttcctcaac ggcaaggaca actacgagat cgaccgcgag       120
     gtgctgcgcc gggtgcagca ggtgacaccg gaggcggcga cgctggcggt ggacaaccgg       180
     gggttcctga tcagggcgac caggttcctg gccagccaga ccgggatcac gcagtacctg       240
     gactgcggtt cggggctgcc cacggcggag aacacccacc aggtcgtgca gcggctccag       300
     cccgaggcgc gggtggtgta cgtggacaac gacccggtgg tgctggcgca cgggcgggcg       360
     ctgctggagg agaacgacca gacgcacttc tcggcggcgg acatcttcga ccccgaggcg       420
     atcctggacg acccggtggt gcgcgagcac atcgacttca gcaagccggt ggcgctgctg       480
     cagctcggga cgatgcacca ccacaacggg acctcgccga cgtcgcggga gatcatggcg       540
     aagtacgtgg acgcgctgcc gtccggctcc ttcgtggcgc tgagccactt cctcgacccg       600
     gagaccgagg agctgagccg gttggcgcgg cggatggagc aggcgttcct gcacagtccc       660
     atgggcagcg ggaagttcat cacgcgcgcg gagctgctgg ggctgttcga cgggctggag       720
     ctggtcgagc ccggactggt gatctgcgcc gactggtggc cggacgggcc tcagctcaag       780
     gagctggcgc cggtgtcgcg ctgcatcgcg ggcgcggtcg gctggaagcg gtga             834
//

If you have problems or comments...

PBIL Back to PBIL home page