(data stored in ACNUC7421 zone)

EMBL: CP001630.PE559

CP001630.PE559       Location/Qualifiers
FT   CDS_pept        615946..616830
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0566"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0566"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34533"
FT                   /db_xref="UniProtKB/TrEMBL:C6WJA1"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACU34533.1"
FT                   /translation="MATGEPRLPSGERDSGPTALRIVLGAQLRRLREAAEITRAQAGYQ
FT                   IRGSDSKISRLELGRVGLKERDVSDLLTMYGMVDEDARQKFLAMVRRSNEPGWWHRYTD
FT                   LMPDWFQDYVGLEEAATRILSYETHFVPGLLQTEDYARAIASHGRPELAGPEVQRRVTL
FT                   RMSRQKVLARPGAPRLWVVIDESVLHRPIGGRQVLLDQLDHLLEVTKQPLVTLQVVPFP
FT                   LSGYAAEGPFTMLRFGEPDLPDIVYVEHLAGALYLDKPEELEIYGRVFDRLTVDAETPD
FT                   RSRQALVKARAAL"
     atggccaccg gtgagccccg gctccccagc ggcgagcggg acagcggccc caccgcgctg        60
     aggatcgtgc tcggcgccca gctgcgcagg ctgcgcgagg ccgcggagat cacccgagcc       120
     caggccggct accagatcag gggctccgac tccaagatca gccgcttgga gctgggccgg       180
     gtcgggttga aggagcgcga cgtctccgac ctgctgacca tgtacgggat ggtcgacgag       240
     gacgcgcggc agaagttcct ggcgatggtc cgcaggtcca acgagccggg gtggtggcac       300
     cgctacaccg atctgatgcc cgactggttc caggactacg tcgggctgga ggaggcggcg       360
     acccgcatcc tcagctacga gacgcacttc gtgcccggcc tgctccagac cgaggactac       420
     gcgcgcgcca tcgccagcca cggcaggccg gagctggcgg gcccggaggt gcagcgccgg       480
     gtgacgctgc ggatgagccg ccagaaggtg ctcgccaggc ccggcgcgcc ccggctgtgg       540
     gtggtgatcg acgagtcggt gctgcaccgg ccgatcggcg gcaggcaggt cctcctcgac       600
     cagttggacc acctcctgga agtgaccaag cagccgctcg tcaccctcca agtggtccca       660
     ttcccactca gcggatatgc cgccgaaggg ccgttcacga tgctccggtt cggggaaccg       720
     gacctgccgg acatcgtcta cgtggagcac ctcgcgggcg cgctctacct ggacaaaccc       780
     gaggagctgg agatctacgg gcgggtgttc gaccggctca ccgtcgatgc ggagacgccc       840
     gatcgcagca ggcaggcatt ggtgaaggcg cgcgccgcgc tgtga                       885
//

If you have problems or comments...

PBIL Back to PBIL home page