(data stored in ACNUC7421 zone)

EMBL: CP001630.PE56

CP001630.PE56        Location/Qualifiers
FT   CDS_pept        complement(64376..65581)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0056"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: sus:Acid_4178 ribonuclease"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0056"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34030"
FT                   /db_xref="GOA:C6WDN5"
FT                   /db_xref="UniProtKB/TrEMBL:C6WDN5"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACU34030.1"
FT                   /translation="MNWQEELRKLDEELAAGRISADDYRTRRDQVLSSAQPAAQPAPPQ
FT                   EWQAQQPSGGPSNGPTGTSTGATQYIQPVNPDATQVVPGGGNRPGHNPDATQVVPGGGN
FT                   RPGDSDRTQVVPNGGMAPQYGQPSPAGGFPQPGAFGGPQQGGGMPPWQGGGGDTSAPWA
FT                   SSSSDNWLRQGPEVFDEGSSGGGKKVFAIIGVVLVVALIGGAVWFFGFKGSGDDSAKGG
FT                   DTPAPQSSTSAPTTTTTKAPIDLLPDPPGTPSTNNGTVELARAVEEKLLSADEAAAVEE
FT                   AAVKEVAFVGSTQDAFTYDAMVFEVGDEAKAEALVEGLVAAQGKTGMVDGAKGQLPAQS
FT                   TVQQLIRQGEPGIYRAIYAAGDKVVRVSTTQTPIAPGPNDQELIKKFQEFGIGVAKQFP
FT                   TS"
     gtgaactggc aggaggaact gcgcaagctg gacgaggagc ttgccgcagg gcggatctcg        60
     gccgacgact accggacccg ccgggaccag gtgctgtcct cggcccaacc cgccgcccag       120
     ccagcgccgc cgcaggagtg gcaggcgcag cagccctcgg gcgggccctc gaacggcccc       180
     accggcacca gcaccggggc cacccagtac atccagccgg tgaacccgga cgccacccag       240
     gtcgtgcccg gcggcggcaa ccgccccggc cacaacccgg acgccacgca ggtggtgccc       300
     ggcggcggca accggcccgg cgactcggac cgcacccagg tcgtgccgaa cggcgggatg       360
     gcaccgcagt acggccagcc ctcgccggcg ggcggcttcc cgcagcccgg cgcgttcggc       420
     ggcccgcagc agggcggcgg gatgccgccg tggcagggcg gtggcgggga cacgtccgcg       480
     ccgtgggcgt cgtcgtcgag cgacaactgg ctgcggcagg gccccgaggt gttcgacgag       540
     ggctcgtccg gcggcggcaa gaaggtcttc gcgatcatcg gcgtcgtgct ggtggtagcg       600
     ctgatcggcg gcgcggtgtg gttcttcggc ttcaagggct ccggcgacga ctcggccaag       660
     ggcggcgaca cgcccgcccc gcagtcgtcc acctcggcgc cgaccacgac caccaccaag       720
     gcgccgatcg acctgctgcc cgacccgccc ggcacgccga gcaccaacaa cggcacggtc       780
     gagctggcgc gcgcggtcga ggagaagctg ctgagcgccg acgaggccgc cgccgtcgag       840
     gaggccgccg tcaaggaggt cgcgttcgtg ggcagcacgc aggacgcgtt cacctacgac       900
     gccatggtgt tcgaggtcgg cgacgaggcc aaggccgagg cgctggtcga gggcctggtc       960
     gcggcgcagg gcaagaccgg catggtggac ggggccaagg gccagctgcc cgcgcagtcg      1020
     acggtgcagc agctgatccg ccagggcgag cccggcatct accgcgcgat ctacgcggcg      1080
     ggtgacaagg tcgtccgggt ctccaccacg cagaccccga tcgcgcccgg cccgaacgac      1140
     caggagctga tcaagaagtt ccaggagttc ggcatcggcg tggcgaagca gttcccgacc      1200
     tcctga                                                                 1206
//

If you have problems or comments...

PBIL Back to PBIL home page