(data stored in ACNUC7421 zone)

EMBL: CP001630.PE560

CP001630.PE560       Location/Qualifiers
FT   CDS_pept        616934..617221
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0567"
FT                   /product="protein of unknown function DUF397"
FT                   /note="PFAM: protein of unknown function DUF397"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0567"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34534"
FT                   /db_xref="InterPro:IPR007278"
FT                   /db_xref="UniProtKB/TrEMBL:C6WJA2"
FT                   /inference="protein motif:PFAM:PF04149"
FT                   /protein_id="ACU34534.1"
FT                   /translation="MHVQMHCLRSFGPKGWSMASRVHNGMSAASLQGVVWRKSARSGAL
FT                   GNCVELAHVDGGIAVRNSRFPDGPALVYTREEVAAFVAGAKDGEFDDLLG"
     atgcacgtgc agatgcactg tctgcggagc ttcggaccga aggggtggag catggcgagc        60
     agggtccaca acggcatgtc ggcggcgtcg ctgcaggggg tggtgtggcg caagagcgca       120
     cgcagcggcg ccctgggcaa ctgcgtggaa ctcgcccacg tcgacggggg gatcgccgtc       180
     cgcaactcgc gcttccccga cggtccggcc ctggtctaca ccagggagga ggtcgccgcc       240
     ttcgtcgccg gcgcgaagga cggcgagttc gatgacctcc tcggctga                    288
//

If you have problems or comments...

PBIL Back to PBIL home page