(data stored in ACNUC7421 zone)

EMBL: CP001630.PE561

CP001630.PE561       Location/Qualifiers
FT   CDS_pept        617205..617510
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0568"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0568"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34535"
FT                   /db_xref="UniProtKB/TrEMBL:C6WJA3"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACU34535.1"
FT                   /translation="MTSSADQGGRTAGQLRQLIARGFQFLHPRDARGELAAVVGVRAHH
FT                   TVIDVVRLHDADNAVATRMPADESNVLFPSRFSWRSRGSATAVLEELLELPDDRMT"
     atgacctcct cggctgacca ggggggccga acagccgggc agttgcgcca gttgatcgcg        60
     cgggggttcc agttcctgca cccgcgcgac gcgaggggtg aactggcggc tgtcgtcggc       120
     gtccgcgccc accacaccgt gatcgacgtg gtcaggctgc acgacgcgga caacgcggtc       180
     gcgacccgga tgcccgccga cgagtcgaac gtgctgttcc ccagcaggtt ctcgtggcgc       240
     agccggggat cggcgaccgc ggtgctggaa gagctcctcg aactaccgga cgaccggatg       300
     acctag                                                                  306
//

If you have problems or comments...

PBIL Back to PBIL home page