(data stored in ACNUC7421 zone)

EMBL: CP001630.PE562

CP001630.PE562       Location/Qualifiers
FT   CDS_pept        complement(617909..619162)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0569"
FT                   /product="membrane-bound lytic murein transglycosylase
FT                   B-like protein"
FT                   /note="KEGG: hypothetical LOC586091"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0569"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34536"
FT                   /db_xref="InterPro:IPR023346"
FT                   /db_xref="InterPro:IPR031304"
FT                   /db_xref="UniProtKB/TrEMBL:C6WJA4"
FT                   /inference="protein motif:COG:COG2951"
FT                   /protein_id="ACU34536.1"
FT                   /translation="MAVEDSDGLTPAATPESPPRGREADRAAGAEPAPPATTGAKGIPV
FT                   NVLEAYREAERSLAGSCNLRWYHLAGIGKVESGHARGGRADPAGETAPQILGPVLDGGE
FT                   FAAIRDTDGGRHDGDRTWDRAVGPMQFIPSTWQRYAADGNGDGASSPHNIHDSAVAAGK
FT                   YLCSGGMDLAKQSDLDAAVFRYNHSRTYVVAVETWMRAYSDGAVEVPALPPGADEDEGG
FT                   SDGGKPEGAGASGESSSTAPESAAPESASEAAASEAAAAESAAADSSAPGSSAPDSSAP
FT                   DSSAPDSSAPDSSAPDSSAPGSAGSPAPDQQAPAAPDAVGANPQGQAVQGGQAANSAPQ
FT                   QAGAPPVETKRPAAPEPQQVDRCLVLVQEHAQASRPVAPTADEVRQAGCTAEQVAAIER
FT                   LFELSTPVDSPVEKSARE"
     atggcggtgg aggactccga cggcctgaca ccggcggcga cacccgagtc cccgccgcgg        60
     ggtcgggagg ccgatcgcgc ggcgggggcg gaaccggcgc cgcccgcgac cacgggggcc       120
     aagggcatcc cggtgaacgt gctggaggcg taccgcgagg ccgagcggtc gctcgccggg       180
     tcgtgcaacc tgcgctggta ccacctggcg ggcatcggga aggtcgagtc ggggcacgcg       240
     cgcggcgggc gggccgaccc cgccggggag accgcgccgc agatcctcgg gccggtgctg       300
     gacggcgggg agttcgcggc gatccgggac accgacggcg gtcggcacga cggggaccgg       360
     acctgggacc gcgcggtcgg gccgatgcag ttcatcccgt cgacgtggca gcgctacgcc       420
     gccgacggca acggcgacgg ggcgtccagc ccgcacaaca tccacgactc ggcggtcgcg       480
     gccgggaagt acctgtgctc gggcgggatg gacctggcga agcagagcga cctggacgcg       540
     gcggtgttcc ggtacaacca ctcgcggacc tacgtggtgg cggtggagac ctggatgcgg       600
     gcctactcgg acggcgcggt ggaggtgccc gcgctgccgc cgggcgcgga cgaggacgag       660
     ggcggttccg acggcgggaa gccggaaggc gccggggcgt cgggggaatc gtcgtcgacc       720
     gcgccggagt cggcggcccc ggagtcggcg tctgaggctg cggcgtctga ggctgcggcg       780
     gccgaatcag cagccgcgga ctcctcggct ccgggctcct cggctcccga ttcgtcagcg       840
     cccgactcct cggctcccga ctcctcggcg cccgactcct cggcgcccga ctcctcagcg       900
     ccgggttcgg cggggtcccc cgcgcccgac cagcaggccc cggcggcgcc ggacgcggtc       960
     ggcgcgaacc cccagggcca ggcggtccag ggcggtcagg cggcgaactc cgcgccgcag      1020
     caggcgggag cgccgcccgt cgagaccaag cggcccgccg cgccggaacc gcagcaggtg      1080
     gaccggtgcc tggtgctggt ccaggagcac gcgcaggcgt cgcggccggt cgcgccgacc      1140
     gccgacgagg tgcgccaggc cgggtgcacc gccgagcagg tcgcggcgat cgaacgcctg      1200
     ttcgaactct ccacacctgt ggacagccct gtggagaagt ccgcgcgcga gtag            1254
//

If you have problems or comments...

PBIL Back to PBIL home page