(data stored in ACNUC7421 zone)

EMBL: CP001630.PE563

CP001630.PE563       Location/Qualifiers
FT   CDS_pept        619562..625705
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0570"
FT                   /product="conserved repeat domain protein"
FT                   /note="TIGRFAM: conserved repeat domain protein; LPXTG-
FT                   motif cell wall anchor domain protein; PFAM: Cna B domain
FT                   protein; Pericardin like; KEGG: gme:Gmet_2043 hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0570"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34537"
FT                   /db_xref="GOA:C6WJA5"
FT                   /db_xref="InterPro:IPR001434"
FT                   /db_xref="InterPro:IPR008969"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR018247"
FT                   /db_xref="InterPro:IPR019931"
FT                   /db_xref="InterPro:IPR033764"
FT                   /db_xref="UniProtKB/TrEMBL:C6WJA5"
FT                   /inference="protein motif:TFAM:TIGR01451"
FT                   /protein_id="ACU34537.1"
FT                   /translation="MPEIGMARRLTAAMISTGLALGGTLVATGVAEATVVTNFTPVYEK
FT                   SVYGDFVQTGNGNMGCPTGADPASLNSLSFTDCVTAQGGTATGNNGRESHYMKYVDADG
FT                   GGNVATYNSSIAKVNIPAGATIDYARLHWGGNTGVFRNATDATGNRGCAPGYTSSASTF
FT                   PAGNPATAQISMAIGAGTPLTIGPDSYVADDAPTLVQNEAQQYVAWTDVKSLLGPAVTG
FT                   SDVNLTIGNIWTPQGYGCHAGWSLTAVYALPNPTGGAIKRSIQIKNGYVKQHASEGNYT
FT                   TSLETLDGASKTTGSRLGVTAFGGHQNLTSDALSYKGTALTEPRLNNSTNFFASTATNQ
FT                   VTPSVVNNFSVDAKVAVPTNVAVGDRSGAVVVGSGSDTFVLSSLAMSVPTPGIYITATP
FT                   RTTPPYYQGDSVIYDVVVGTSDNQTITNVGVSNTDQAFGDCNRPSTATLTSGNPTLSYS
FT                   CTVPAGTANFNNTIQAVGANAFLEPVSDSKTITATVSTIGLSLTKTADKATYSAGETIT
FT                   FTVTAANTGNTALTNVAIADAKVNACAKNQATLAAGAQLVSTCTATAPIAGDANTATVS
FT                   ATDARGGTVNNTATANAYSEGAISGRVFADRDDNGAFDAPMGDTNLVNVGISLTGTETN
FT                   GGAPVSLNTVTAPDGTWSFANLKAGNYTVTKDPTPDYDPGKRTPGNAATAPLNTETFTV
FT                   ALPGGQSSTGNLFAVIPTSSLSGFVYEDSNNNGVKDTGEKGIQGVAIALSGIDDGGNAA
FT                   NWNTSTDVDGAYTFKALRQGNYNLSETQPAGWTDGKDTPGSAGGTRDAPDSIVNIQLDP
FT                   RVTAIDYLFGEYKGTSIAGKVVDDKDMGIAGVKLTVTGGAGPLEATTDAGGAFSFTLAP
FT                   GTYTLTEEQPLGYAQGTDTVGTTGGTHSAENTFSAIVLKSGDAGTGYVFKEKRGSLTGY
FT                   VYEDKNGNGNKDAAEPGIANVSVKMTGTDAMSRPVNTTMTTNSQGLYTFAGVVGGTYSL
FT                   TETQPEGYENGVDKAGTVGGDYTPPDTISDISFPAGADATGYLFGEYKFGSIYGEVLND
FT                   KGNPIANVKITLENDERAPIGQMTMTDEFGQFVFEDIVPGTYKLVEEQPAGYADGPDTA
FT                   GTGGGDTSVADTIGLIPVGSGDILTGYQFTEKRGSLAGYVYEDTNNNGLKDTGEKGIQG
FT                   TELTLTGTDAQGKAVNLTATTDAAGLYKIEFIVGGTGYTLSEKQPAGYVTGKNKVGSQG
FT                   GTLTAPDKVTGITFSAGAAATGYLFGELTPASLAGDVVNEKGEGIAGVTVVLTGTDDMS
FT                   TTVNKSAVTTAGGKYAFNSLRPGTYNVTETQPDGYGQGTATPGSAGGTALGADEITGVV
FT                   ITSEAKATGYRFSEKRGSLSGVVFDDRDNDGVRDDGEPGIQGVTLTLKGNSEWCAVGEP
FT                   DGTDTETDNGTGTPTPDTGTDPGTGTDPGTGTDPGTGTDPGTGTDPGTGTDPGTGTDPG
FT                   TGTDPGTGTDPGTGTDPGTGTDTGTDPGTGSGGTPDTGVGAGGTPDTGGGRVDPTDATA
FT                   DATTADGEMTTMADPAVSAGDAAPTCAVTLTATTDASGVFSFAGLVGGTYDLMETQPAA
FT                   YADGKDTAGTAGGTVTAPDAIMGIVLAGGVDATGYLFGERAGVITGTVWVDANGDGKID
FT                   TTELGRIAGAKVDLMQGDSTTPLASATTTTEGTYEFKDVPAGDYSLMLTLPMGYGATTP
FT                   TTVKVTTTTTSGTNVDFGVQKGAIGDFVWDDLNRNGLQDAGEPGIAGVKVNLLDEQGEV
FT                   KSSTTTNASGKYMFGDLDEGTYRVQFTVPTGRTFTAQNAGAPEKSSAVDRSNGLSGPIV
FT                   FKVADSKVMQNMNVDAGVVDRITDLGVTLTADNPSPQVGSQVVITSKVVNTGTVPVNGA
FT                   IATITIPQGLTINGVDGGAPQAQGVAMARAARADEGWTCAVNGQQVVCTTPDVIQPGAS
FT                   SLPITITTTANSAFTTTNATALVTLADGTGDDNPANDGATTPALSTETPSTGGPNTGGG
FT                   TTQQPMPPMPPNGMGNMPLAWTGSEIRPVLIGGLALLLAGLGTLFLGKRRRKQGM"
     atgcccgaga tagggatggc gcgccgcctc accgcggcca tgatttccac tggcctagcg        60
     ctgggaggca cgctggtcgc gacgggggtc gccgaagcga ccgtcgtcac caacttcacc       120
     cccgtgtacg aaaagtccgt ctacggcgac ttcgtccaga cgggcaacgg caacatgggc       180
     tgcccgacgg gggccgaccc ggcctcgctc aacagcctgt ccttcacgga ctgcgtgacc       240
     gcccagggcg gcacggccac cggcaacaac ggccgcgagt cccactacat gaagtacgtg       300
     gacgcggacg gcgggggcaa cgtcgccacg tacaactcct cgatcgccaa ggtcaacatt       360
     ccggcgggcg cgaccatcga ctacgcccgg ctccactggg gcggcaacac cggcgtcttc       420
     cgcaacgcca cggacgccac cggcaaccgg ggctgcgcgc ccggctacac cagctcggcg       480
     agcaccttcc cggcgggcaa ccccgccacc gcccagatct cgatggccat cggcgcgggg       540
     accccgctga ccatcggccc cgactcctac gtcgccgacg acgccccgac gctggtgcag       600
     aacgaggccc agcagtacgt ggcgtggacc gacgtcaaga gcctgctcgg cccggccgtc       660
     accggctccg acgtcaacct gaccatcggc aacatctgga ccccccaggg ctacggctgc       720
     cacgcgggct ggtcgctgac cgccgtctac gccctcccca acccgaccgg tggcgcgatc       780
     aagcgctcca tccagatcaa gaacggctac gtcaagcagc acgcctccga gggcaactac       840
     acgacctcgc tggagaccct cgacggggcc agcaagacga ccggcagccg cctcggcgtc       900
     acggccttcg gcggccacca gaacctgacc tccgacgcgc tgtcctacaa gggcaccgcg       960
     ctcaccgagc ccaggctcaa caactcgacg aacttcttcg cgtccacggc gaccaaccag      1020
     gtcacgccgt cggtcgtgaa caacttcagc gtcgacgcca aggtcgcggt gccgaccaac      1080
     gtcgcggtgg gcgaccggag cggcgccgtg gtcgtgggca gcggcagcga cacgttcgtg      1140
     ctctccagcc tcgccatgtc cgtgccgacc cccggcatct acatcaccgc gacgccgagg      1200
     accaccccgc cgtactacca gggcgactcg gtcatctacg acgtcgtggt cggcacctcg      1260
     gacaaccaga cgatcacgaa cgtcggggtc agcaacaccg accaggcgtt cggggactgc      1320
     aacaggccca gcaccgccac gttgaccagc ggcaacccca cgctctcgta ctcgtgcacc      1380
     gtcccggcgg ggaccgcgaa cttcaacaac accatccagg cggtgggcgc caacgccttc      1440
     ctggagccgg tcagcgactc caagacgatc acggcgaccg tgagcaccat cggcctgtcg      1500
     ctgaccaaga ccgccgacaa ggcgacctac agcgcgggcg agacgatcac cttcaccgtc      1560
     accgccgcga acaccggcaa cacggcgctg accaacgtcg cgatcgccga cgcgaaggtg      1620
     aacgcctgcg ccaagaacca ggcgaccctc gcggcgggcg cgcagctcgt ctccacgtgc      1680
     acggccaccg cgccgatcgc cggtgacgcg aacacggcca ccgtgtcggc caccgacgcg      1740
     cgtggcggca ccgtcaacaa cacggccacc gcgaacgcct actccgaggg cgccatctcc      1800
     ggccgggtct tcgccgaccg cgacgacaac ggcgcgttcg acgcccccat gggcgacacc      1860
     aacctggtga acgtcgggat ctcgctgacc ggcaccgaga ccaacggcgg cgccccggtc      1920
     agcctgaaca cggtcaccgc gcccgacggc acgtggtcct tcgcgaacct gaaggcgggc      1980
     aactacaccg tcaccaagga cccgacaccg gactacgacc ccggcaagcg cactccgggc      2040
     aacgcggcca ccgcgcctct caacaccgag acgttcaccg tcgcgctccc cggcggccag      2100
     tcctccaccg gcaacctgtt cgccgtgatc cccacgtcga gcctgtccgg cttcgtctac      2160
     gaggacagca acaacaacgg cgtcaaggac accggtgaga agggcatcca gggcgtcgcg      2220
     atcgcgctga gcggcatcga cgacggcggc aacgcggcga actggaacac cagcaccgac      2280
     gtcgacggcg cgtacacctt caaggccctg cgccagggca actacaacct gtccgagacc      2340
     cagcccgcgg gctggaccga cggcaaggac acccccggct cggcgggcgg cacgcgcgac      2400
     gcgccggact cgatcgtcaa catccagctc gacccgcgcg tcaccgccat cgactacctg      2460
     ttcggcgagt acaagggcac gtcgatcgcg ggcaaggtcg tggacgacaa ggacatgggc      2520
     atcgcgggcg tcaagctcac ggtgaccggc ggcgccggtc cgctggaggc gaccaccgac      2580
     gcgggcggcg cgttcagctt caccctcgcg ccgggcacct acaccctcac cgaggagcag      2640
     ccgctcggct acgcccaggg caccgacacg gtgggcacca ccggcggcac ccactcggcg      2700
     gagaacacct tcagcgccat cgtgctgaag tccggcgacg cgggcaccgg ctacgtcttc      2760
     aaggagaagc gcggctcgct gaccggctac gtctacgagg acaagaacgg caacggcaac      2820
     aaggacgccg ccgagccggg catcgcgaac gtcagcgtga agatgaccgg cacggacgcg      2880
     atgtcccgcc cggtcaacac cacgatgacc accaactccc agggcctcta caccttcgcg      2940
     ggtgtcgtcg gcggcaccta ctcgctgacc gagacccagc ccgagggcta cgagaacggc      3000
     gtggacaagg cgggcacggt cggcggtgac tacacgccgc cggacacgat cagcgacatc      3060
     tcgttcccgg cgggcgccga cgcgaccggc tacctgttcg gcgagtacaa gttcggctcg      3120
     atctacggcg aggtcctgaa cgacaagggc aacccgatcg ccaacgtgaa gatcacgctg      3180
     gagaacgacg agcgcgcccc gatcggccag atgacgatga ccgacgagtt cggccagttc      3240
     gtcttcgagg acatcgtccc cggcacctac aagctggtcg aggagcagcc ggccggctac      3300
     gccgacggcc cggacacggc gggcaccggt gggggtgaca cctccgtcgc cgacaccatc      3360
     ggcctgatcc cggtcgggtc cggcgacatc ctcaccggct accagttcac cgagaagcgc      3420
     ggctcgctcg cgggctacgt ctacgaggac accaacaaca acggcctcaa ggacaccggc      3480
     gagaagggca tccagggcac cgagctgacc ctgaccggca ccgacgcgca gggcaaggcc      3540
     gtcaacctga cggcgaccac cgacgccgcc ggtctgtaca agatcgagtt catcgtcggc      3600
     ggcacgggct acacgctcag cgagaagcag cccgccgggt acgtgaccgg caagaacaag      3660
     gtcggcagcc agggcggcac gctcaccgcg cccgacaagg tcaccggcat caccttctcc      3720
     gcgggcgccg cggcgaccgg ctacctgttc ggcgagctga cgcccgcctc gctggccggc      3780
     gacgtggtca acgagaaggg cgagggcatc gcgggcgtga ccgtggtgct gaccggcacc      3840
     gacgacatgt cgacgaccgt caacaagtcc gcggtcacca cggcgggcgg caagtacgcg      3900
     ttcaactcgc tgcgccccgg cacgtacaac gtgaccgaga cgcagccgga cggctacggc      3960
     cagggcacgg ccacccccgg cagcgcgggc ggcacggcgc tgggcgccga cgagatcacc      4020
     ggtgtggtga tcacctcgga ggcgaaggcc accgggtacc gcttcagcga gaagcgcggc      4080
     tcgctctccg gcgtggtctt cgacgaccgc gacaacgacg gcgtgcgcga cgacggcgag      4140
     ccgggcatcc agggcgtgac cctgacgctg aagggcaact cggagtggtg cgcggtcggc      4200
     gagcccgacg gcaccgacac cgagaccgac aacggcacgg gcaccccgac gccggacacg      4260
     ggcacggacc ccggtacggg tactgacccc ggcacgggca ccgaccccgg tacaggtact      4320
     gaccctggca ccggtaccga ccccggtact ggcaccgacc ccggtacggg tactgacccc      4380
     ggcaccggta ccgaccccgg tacgggtacc gaccccggca ctggcaccga ccccggtacg      4440
     ggcacggaca ccggcaccga ccccggcacc ggttcgggcg gcacgcctga caccggcgtg      4500
     ggcgcgggtg gcactccgga caccggtggc ggccgggtcg acccgaccga cgccaccgcc      4560
     gacgccacca ccgccgacgg cgagatgacc accatggccg acccggccgt ctcggcgggc      4620
     gacgccgcgc cgacctgcgc ggtcaccctc accgccacca ccgacgcgtc cggcgtgttc      4680
     tccttcgccg gcctggtcgg cggcacgtac gacctgatgg agacccagcc cgccgcgtac      4740
     gcggacggca aggacaccgc gggcacggcg ggtggcaccg tcaccgctcc cgacgcgatc      4800
     atgggcatcg tgctggcggg cggcgtcgac gccaccggtt acctgttcgg cgagcgcgcc      4860
     ggcgtcatca ccggcacggt ctgggtcgac gccaacggcg acggcaagat cgacaccacc      4920
     gagctgggcc gcatcgcagg cgccaaggtc gacctgatgc agggcgacag caccaccccg      4980
     ctcgccagcg ccaccaccac gaccgagggc acctacgagt tcaaggacgt ccccgcgggc      5040
     gactactcgc tgatgctcac gcttccgatg ggctacgggg cgaccacgcc gaccacggtc      5100
     aaggtcacca cgaccacgac cagcggcacg aacgtggact tcggcgtgca gaagggcgcc      5160
     atcggcgact tcgtgtggga cgacctgaac cgcaacggcc tgcaggacgc tggtgagccc      5220
     ggcatcgccg gggtcaaggt caacctgctg gacgagcagg gcgaggtgaa gagcagcacc      5280
     accacgaacg ccagcggcaa gtacatgttc ggcgacctgg acgagggcac ctaccgcgtc      5340
     cagttcaccg tgcccaccgg ccgcacgttc accgcgcaga acgcgggcgc tcccgagaag      5400
     agctccgcgg tcgaccgctc gaacggcctc agcgggccga tcgtgttcaa ggtggccgac      5460
     agcaaggtca tgcagaacat gaacgtcgac gccggtgtcg tcgaccggat cacggacctg      5520
     ggcgtcaccc tcacggcgga caacccgtcg ccgcaggtgg gctcgcaggt cgtgatcacc      5580
     agcaaggtgg tcaacaccgg gaccgtgccg gtcaacggcg cgatcgcgac gatcaccatc      5640
     ccgcagggcc tgaccatcaa cggggtcgac ggcggcgcgc cgcaggccca gggcgtggcg      5700
     atggccaggg ccgctcgggc ggacgagggc tggacctgcg cggtgaacgg ccagcaggtc      5760
     gtctgcacca cgccggacgt catccagccg ggcgcctcct cgctgccgat caccatcacc      5820
     accaccgcga acagcgcgtt caccaccacg aacgccaccg cgctggtgac gctggcggac      5880
     ggcacgggcg acgacaaccc ggccaacgac ggcgcgacca ccccggccct gtcgacggag      5940
     accccgtcca cgggcggccc caacacgggt ggtggcacga cgcagcagcc gatgcccccg      6000
     atgcccccga acggcatggg gaacatgccg ctcgcgtgga ccggttcgga gatccgaccg      6060
     gtgctgatcg gcggcctggc gctgctcctc gcgggcctgg gaaccctgtt cctcggcaag      6120
     cgcaggcgca agcagggcat gtga                                             6144
//

If you have problems or comments...

PBIL Back to PBIL home page