(data stored in ACNUC7421 zone)

EMBL: CP001630.PE564

CP001630.PE564       Location/Qualifiers
FT   CDS_pept        626473..631002
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0572"
FT                   /product="YD repeat protein"
FT                   /note="TIGRFAM: YD repeat protein; KEGG: rso:RS05482
FT                   putative rhs-related transmembrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0572"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34538"
FT                   /db_xref="InterPro:IPR006530"
FT                   /db_xref="InterPro:IPR022385"
FT                   /db_xref="InterPro:IPR031325"
FT                   /db_xref="UniProtKB/TrEMBL:C6WJA6"
FT                   /inference="protein motif:TFAM:TIGR01643"
FT                   /protein_id="ACU34538.1"
FT                   /translation="MDNPLVAAPRSDTTAVTGIGIAESSVDLANGIADGNWVEAGLGGA
FT                   GVGLEVLSMVIDPVGTVASYGVGWLMEHVQPLKEALDWLAGDPPVIRSFSETWGNVAAE
FT                   VRAVAEELGGQDAPGWEGAAAQAFRGANAETADAIAGAGVLAEGVGIGVMVMGEVVAAV
FT                   RELVRDLVAELVGRLISWALEAVATLGLATPVIVAQATTAISRMCSRIADLVRKLVRTI
FT                   SNVAPRIRSVVDKLGEIMQKLGRLGRRADTPSGPDTPNLAGGRPATPDAPSGTTSPSGT
FT                   TSPSGTTSPSGTTSPSGTPAPSSTTTPSGTSSPDPAPTGTSPGGTTTTSGAAPSPARPD
FT                   SATPDSTSPSARDQAGADPKASARPTSGRPTCGDPVDVVSGQVLLPQTDVALGGALPLL
FT                   LTRTHLSGHRAGARFGTSWASTLDQRLEVDEEGVCFVTEDGMVLLYPHPGATPVLPVEG
FT                   PRWPLSSTGDGGYEVVDAEAGLTRRFTPSAGGPLPLGSITDLNGNRVTVDHDVDGVPTD
FT                   VRHSGGYHVSVRSTGGLVTSLVLAGPEDITLIRYGYDAERRLTEVVNSSGAALRFSYDD
FT                   DQRVVGWQDRNGMWYRYGYDDRGRCVLNEGADDYLSGTFAYLDGRTVYTDALGNRTEFH
FT                   LNRAHQVVREVDAGGGVVVSEWDRHDRLLSRTDQLGRTTTHRYDEDGNLVALVRPDGRE
FT                   STATYDAGRMPLVVEDVDGAVWRREYDPRGNLLAVTDPSGARTRFDRDERGNAVAITGP
FT                   LGEVRRIDYDLAGLPVAITDAEGGRTGYRRDRFGRVREVTDPLGSTTTLGWTVEGRLAS
FT                   RTLPDGSVERWRYDGEGNPVEHVDAAGAVSRTGYTGFDQPAWHVGPDGARLEFGYDPNL
FT                   RLTSVVNARGQAWTYRYGPTGALVVETDFDGRSTTYVHDATGQLTAKVNGAGERIAYEH
FT                   DELGRLRAKRTPHGDTTYDHDPAGRLIRAVSRDADVLVERDLLGRIVAETVNGRTLRSE
FT                   HDASGNRVRRVTPTGAVSEWEHDGTGRATALLAGGRRTAFGYDAAGREVQRLVGDSTRL
FT                   GQVWDANHRLLAQDLTARGARVQRRDYRYRADGNLLAVDDLLAGPRRYELDPAGRVTSV
FT                   LGSGWSEGYAYDRAGELTWATGPGETSGARSYAGTLIRRAGDVHFEHDAQGRVVVRAHR
FT                   TLSGRERTWRYGWDAEDRMVSATTPDGARWAYRYDGLGRRVAKERLDAGGAVVERVDFV
FT                   WDGLVLVEQITAGTALTWDYEPGSHRPLTQVERVLAAPQEWVDARFHAVVSDVVGMPSE
FT                   LLDDAGALVWRSQRTLWGAVLAELAGGPDCPLRFAGQYHDRETGLFYNVHRYYDPETAR
FT                   YSSPDPLGLLAGPNPHAYVVNPLRLTDPLGLSGCERARKIADRVVERAQQGRVREASNY
FT                   HGRLSRERELEILSNPDGVYHSTGSGGRLIFRQGDDILITEGPGSSAGQLVTSYGPSGP
FT                   RGESGASIFGGAPSDPGLPVTHDMIVEGRIPVPGGGTLPAAVQVLPRP"
     gtggacaacc cgctggtagc cgcaccccgg agcgacacga cggcggtgac cgggatcggg        60
     atcgccgagt cgtcggtgga cctggcgaac ggtatcgcgg acgggaactg ggtcgaggcc       120
     gggctcgggg gtgctggggt cgggctggaa gtgctgtcga tggtgatcga cccggtgggg       180
     acggtcgcct cgtacggcgt tgggtggctg atggagcacg tgcagccgct caaggaggcc       240
     ctggactggt tggcggggga tccgccggtg atccgctcgt tcagcgagac ctggggcaac       300
     gtcgcggccg aggtgagggc ggtggccgag gagctgggcg ggcaggacgc gccgggttgg       360
     gagggcgccg cggcccaggc gttccggggt gcgaacgccg agacggccga cgcgatcgcc       420
     ggggcggggg tgctcgcgga gggcgtgggc atcggcgtga tggtgatggg cgaggtggtc       480
     gcggcggtcc gggagttggt ccgtgacctg gtggccgagc tggtgggcag gctgatctcc       540
     tgggccctgg aggcggtggc gaccctgggc ctggccacgc cggtgatcgt cgcgcaggcc       600
     accacggcca tctcgcggat gtgctcgcgg atcgcggacc tggtgcgcaa gctggtcagg       660
     acgatctcga acgtcgcgcc gcgcatccgc tcggtggtcg acaagctggg cgagatcatg       720
     cagaagctcg gccgactcgg ccgccgcgcc gacaccccgt cgggcccgga caccccgaac       780
     ctcgcgggcg gcaggcccgc gacccccgac gcgccgtcgg gcacgaccag cccgtcgggc       840
     acgaccagcc cgtccggcac gaccagcccg tcagggacga ccagcccgtc cggcacacct       900
     gcgccgtcga gcacgaccac gccgtccggg acgagttccc cagacccggc cccgaccggc       960
     acgtcccccg gcgggaccac cacgaccagc ggcgccgcgc cgagcccggc gagaccggac      1020
     agcgcgacac cggacagcac gagccccagc gcgcgcgacc aggcaggcgc cgaccccaag      1080
     gcctccgcgc gcccgacgag cggtcgaccc acctgcggtg accccgtcga cgtcgtctcc      1140
     ggccaggtcc tcctgccgca gaccgacgtc gccctcggcg gcgcgctccc gctgctgctc      1200
     acgcgcaccc acctgtccgg ccaccgcgcg ggcgcccggt tcggcacgtc gtgggcctcc      1260
     accctggacc agcggctcga ggtggacgag gagggcgtct gcttcgtcac cgaggacggc      1320
     atggtcctgc tctacccgca ccccggcgcg acgcccgtcc tcccggtgga gggaccgcgc      1380
     tggcccctgt ccagcaccgg cgacgggggc tacgaggtgg tcgacgcgga ggcggggctc      1440
     acccggcgct tcaccccgag cgcgggcggg ccgctgcccc tcggctccat caccgacctc      1500
     aacggcaacc gcgtcaccgt cgaccacgac gtcgacggcg tcccgaccga cgtccgccac      1560
     tccggcggct accacgtgtc ggtgcgctcg accggcggcc tggtgacctc gctcgtgctc      1620
     gccggtcccg aggacatcac cctcatcagg tacggctacg acgccgagcg caggctcacc      1680
     gaggtggtga actcctcggg cgccgccctg cgcttctcct acgacgacga ccagcgcgtc      1740
     gtcggctggc aggaccgcaa cggcatgtgg taccgctacg gctacgacga ccgggggcgc      1800
     tgcgtcctca acgagggcgc ggacgactac ctctccggga cgttcgccta cctcgacggc      1860
     cgcacggtct acaccgacgc gctgggcaac cggaccgagt tccacctcaa ccgcgcccac      1920
     caggtcgtcc gggaggtcga cgcgggcggt ggcgtcgtgg tgtccgagtg ggaccgccac      1980
     gaccggctgc tctcccggac cgaccagctc ggccgcacca ccacccaccg ctacgacgag      2040
     gacggcaacc tggtcgcgct cgtccgcccg gacggccggg agtcgaccgc gacctacgac      2100
     gcgggccgga tgccgctcgt ggtcgaggac gtggacggcg cggtgtggcg gcgcgagtac      2160
     gaccccaggg gcaacctcct cgcggtcacc gacccctcgg gcgcgcgcac ccggttcgac      2220
     cgggacgagc gcggcaacgc cgtggcgatc accggcccgc tcggcgaggt ccgccggatc      2280
     gactacgacc tcgcgggcct gcccgtcgcg atcaccgacg cggagggcgg tcgcaccggc      2340
     taccggcgcg accggttcgg ccgcgtgcgc gaggtgaccg acccgctcgg ctcgaccacc      2400
     accctcggct ggacggtcga gggcaggctc gcctcccgca ccctccccga cggctcggtg      2460
     gagcggtggc ggtacgacgg cgagggcaac ccggtcgagc acgtcgacgc ggcgggcgcc      2520
     gtctcccgca ccgggtacac cgggttcgac cagcccgcct ggcacgtcgg cccggacggc      2580
     gcgcggctgg agttcggcta cgaccccaac ctgcgcctga cctccgtggt caacgcgcgg      2640
     gggcaggcgt ggacctaccg ctacggcccg accggggcgc tggtggtgga gacggacttc      2700
     gacggccggt ccacgaccta cgtccacgac gccaccgggc agctgaccgc caaggtcaac      2760
     ggcgcggggg agcggatcgc ctacgagcac gacgagctgg gcaggctgcg cgccaagcgc      2820
     acgccccacg gcgacaccac ctacgaccac gacccggcgg ggcggctgat cagggcggtc      2880
     agccgcgacg cggacgtgct ggtcgagcgc gacctgctcg gccggatcgt cgcagagacg      2940
     gtcaacgggc gcaccctgcg ctcggagcac gacgcgtcgg gcaaccgcgt ccgcagggtg      3000
     accccgaccg gcgcggtcag cgagtgggag cacgacggga cgggcagggc cacggcgctg      3060
     ctggcgggcg gcaggcgaac cgcgttcggg tacgacgccg ccgggcggga ggtccagcgc      3120
     ctggtcggcg actcgacccg cctcggccag gtgtgggacg ccaaccaccg gctgctggcc      3180
     caggacctca ccgcgcgcgg cgcgcgcgtg cagcgcaggg actaccggta ccgcgccgac      3240
     ggcaacctgc tcgcggtcga cgacctcctg gcggggccgc gccggtacga gctggacccg      3300
     gcggggcggg tgacctcggt gctcggcagc ggctggagcg agggctacgc gtacgaccgg      3360
     gcgggcgagc tgacctgggc gaccgggccg ggcgagacct cgggcgcgcg gtcgtacgcg      3420
     ggcacgctga tccggcgggc gggcgacgtc cacttcgagc acgacgcgca gggccgggtg      3480
     gtcgtccggg cgcaccgcac gctgtccggg cgggagcgga cctggcggta cggctgggac      3540
     gccgaggacc ggatggtgtc cgcgacgacc ccggacggcg cccggtgggc gtaccgctac      3600
     gacgggctcg gcaggcgggt ggcgaaggag cggctcgacg cgggcggcgc cgtcgtggaa      3660
     cgggtcgact tcgtctggga cggcctggtc ctcgtcgagc agatcaccgc cgggaccgcg      3720
     ctgacctggg actacgagcc cggttcgcac cgccccctca cccaggtcga gcgggtgctg      3780
     gccgcgccgc aggagtgggt cgacgcccgg ttccacgcgg tggtgtcgga cgtggtgggg      3840
     atgccctcgg agctgctcga cgacgcgggc gcgctggtgt ggcgctcgca gcggaccctg      3900
     tggggcgccg tcctggcgga gctggctggc ggcccggact gcccgctgcg gttcgcgggc      3960
     cagtaccacg accgggaaac gggcctgttc tacaacgtcc accgctacta cgacccggag      4020
     accgcgcgct acagctcccc tgacccgctg ggcctgctgg cgggcccgaa cccgcacgcc      4080
     tacgtcgtga acccgctcag gctgaccgac ccgctggggc tgagcggctg cgagcgggcg      4140
     cggaagatcg ccgaccgggt cgtcgagcgg gcccagcagg ggagggtgcg cgaggcgtcc      4200
     aactaccacg gcaggctgtc gcgggagcgg gagctggaga tcctgtccaa cccggacggc      4260
     gtgtaccact ccaccggcag cggcggacgg ctgatcttcc gccagggcga cgacatcctg      4320
     atcaccgagg ggccgggcag cagcgcgggc cagctggtca ccagctacgg cccgtccggc      4380
     ccgaggggcg agagcggcgc gtccatcttc ggcggcgccc cgtccgaccc agggttgccg      4440
     gtgacccatg acatgatcgt cgagggcagg atcccggtcc ccggcggtgg cacgctcccc      4500
     gccgcggtcc aggtgctgcc gcgtccgtag                                       4530
//

If you have problems or comments...

PBIL Back to PBIL home page