(data stored in ACNUC7421 zone)

EMBL: CP001630.PE565

CP001630.PE565       Location/Qualifiers
FT   CDS_pept        631013..631729
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0573"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0573"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34539"
FT                   /db_xref="UniProtKB/TrEMBL:C6WJA7"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACU34539.1"
FT                   /translation="MDFEVARGEPLPHVPRLVLDTRAVLVGPYGSAVEHERHVLDTAGA
FT                   GGWPDTEDDEYRFDRDTGTLVSALLHIPDAQTSALPWHIPPGEPAALRTQAAQPRPPAP
FT                   THWLSPDTSTLVCAYASHPAPLPPLHRVDTAPDFALLLLPDNTLSGWLLAHPDRHVTTA
FT                   WEQATPELPDEPFRAAFTTYFSLTTPEAVEALEDGAPNVLSQLSELRDTIPLSEGVHSR
FT                   RAALHHAVEGLLDFYG"
     gtggacttcg aggtcgcgcg gggcgagccc ctgccgcacg tgccgaggct ggtgctggac        60
     acccgcgcgg tgctggtcgg cccgtacgga agcgcggttg agcacgagcg gcacgtgctg       120
     gacacggccg gggcgggcgg ttggccggac accgaggacg acgagtaccg cttcgaccgc       180
     gacaccggga ccctggtcag cgccctgctc cacatcccgg acgcgcaaac gtcggccctc       240
     ccctggcaca tcccgccggg cgagccagcc gcactccgca cccaggcagc ccagccccgc       300
     cctcccgccc cgacccactg gctgtcccct gacacgtcaa ccctggtgtg cgcctacgcg       360
     agccaccccg ctcctcttcc cccgcttcac cgcgtggaca ccgcccccga cttcgccctg       420
     ctgctcctcc cggacaacac cctgtccggc tggctcctgg cccacccgga ccgccacgtg       480
     accacggcgt gggagcaggc gacccccgaa ctccccgacg agcccttccg cgccgcgttc       540
     accacctact tcagcctcac caccccggag gctgtcgagg ccctggagga cggcgccccg       600
     aacgtcctgt cccagctgtc agaactacgc gacacgatcc ccctgtccga gggcgtccac       660
     tcccgcagag cggctctcca ccacgcggtc gagggcttgc tggacttcta cggctga          717
//

If you have problems or comments...

PBIL Back to PBIL home page