(data stored in ACNUC7421 zone)

EMBL: CP001630.PE566

CP001630.PE566       Location/Qualifiers
FT   CDS_pept        631738..632154
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0574"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0574"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34540"
FT                   /db_xref="UniProtKB/TrEMBL:C6WJA8"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACU34540.1"
FT                   /translation="MTTREDLHALLTTPDLPHPERTRRVRALTDVEDHITQTPSMTPIL
FT                   CKALSLRSRAAPNEDILQVLAEIKAPTSLPCLREALHWQPEWDEFDQVGVKALWAINAV
FT                   NTAEARRLVAGAAERGPEAVRDWARRKLDQHPAE"
     atgacaacac gcgaggacct gcacgccctc ctgacgaccc cggacctgcc gcaccccgag        60
     cgaacgcggc gcgtccgagc gctgaccgac gtcgaggacc acatcaccca gacgccgtcg       120
     atgaccccaa tcctgtgcaa ggccctgagc ctgagatccc gcgccgcgcc gaacgaggac       180
     atcctgcagg tgctggccga gatcaaggcc ccgacatcgc tgccctgcct gcgtgaggcg       240
     ctccactggc agccggagtg ggacgagttc gaccaggtgg gcgtgaaggc gctgtgggcg       300
     atcaacgcgg tgaacaccgc cgaggcgcga cggttggtgg caggggcggc ggaacgcggc       360
     ccggaggcgg tccgcgactg ggcccgccgc aagctggacc agcacccggc agagtga          417
//

If you have problems or comments...

PBIL Back to PBIL home page