(data stored in ACNUC7421 zone)

EMBL: CP001630.PE567

CP001630.PE567       Location/Qualifiers
FT   CDS_pept        complement(632186..632659)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0575"
FT                   /product="NUDIX hydrolase"
FT                   /note="PFAM: NUDIX hydrolase; KEGG: bbt:BBta_3942 putative
FT                   NUDIX-like hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0575"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34541"
FT                   /db_xref="GOA:C6WJA9"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="InterPro:IPR020084"
FT                   /db_xref="UniProtKB/TrEMBL:C6WJA9"
FT                   /inference="protein motif:PFAM:PF00293"
FT                   /protein_id="ACU34541.1"
FT                   /translation="MARTDHYDDPNAPEATRIVVAVTAFVQDQQGRLLMIRRTDNGLYS
FT                   IPGGAQDVGETIGRTVVREVKEETGVDVEPVDVIGVYSDPAHVVSYTDGEVRQEFSICF
FT                   RATLVGGELRTSGESSEVCWIGRDELAALDIHPSIRLRIEHGFGARDRPYFAT"
     atggcgcgca ctgaccacta cgacgacccg aacgcccccg aggcgacccg catcgtcgtg        60
     gcggtgacgg ccttcgtcca ggatcagcag ggcaggctgt tgatgatccg gcgaaccgac       120
     aacgggctgt attccatccc cggcggggcg caggacgtgg gcgagaccat tggtcgcacc       180
     gtggtgcgcg aggtcaagga ggagaccggc gtcgacgtcg agcctgtgga cgtcatcggc       240
     gtctactcgg accccgccca cgtcgtctcc tacaccgacg gcgaggtccg ccaggagttc       300
     tcgatctgct tccgggccac gttggtgggc ggtgagctgc gcaccagcgg cgagtccagc       360
     gaggtgtgct ggatcgggcg cgacgagctg gccgcgctcg acatccaccc gtccatccgg       420
     ctgcggatcg agcacgggtt cggcgcgcgg gacaggccgt acttcgccac ctga             474
//

If you have problems or comments...

PBIL Back to PBIL home page