(data stored in ACNUC7421 zone)

EMBL: CP001630.PE568

CP001630.PE568       Location/Qualifiers
FT   CDS_pept        633802..636642
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0576"
FT                   /product="transcriptional regulator, SARP family"
FT                   /note="PFAM: transcriptional activator domain;
FT                   Tetratricopeptide TPR_4; TPR repeat-containing protein; NB-
FT                   ARC domain protein; transcriptional regulator domain
FT                   protein; Tetratricopeptide TPR_2 repeat protein; SMART:
FT                   Tetratricopeptide domain protein; KEGG: scl:sce5225 protein
FT                   kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0576"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34542"
FT                   /db_xref="GOA:C6WJB0"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR002182"
FT                   /db_xref="InterPro:IPR005158"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:C6WJB0"
FT                   /inference="protein motif:PFAM:PF03704"
FT                   /protein_id="ACU34542.1"
FT                   /translation="MEFGLLGPLAISHEGSPITLTKAVPRATLAVLLLHHGHPVAVERI
FT                   IDVVWSEADGPPLTARSMVQRSVNSLRELFKVDPETTLRTRPGGYELTCREGALDLRRF
FT                   EDLVDQADGCGSLREMAAVLREALRLWRGDPLSDVTNRGLESFKTGLTERRLTVVERCI
FT                   ELELQLGRHQEIVAELQSWTDTHPFRESLLALLMLALHRGGRTTDALAAYADFRARLAE
FT                   EVGTDPGTAVRMLHERILNNDHTLAAPVQRGVDTAIPQTATDHADTPSQPAWVVPRQLP
FT                   AGPRWLVGRDEQLAQLGQALAARETGQMAGAGTPVVVVVDGMAGIGKTALALTFAHQVS
FT                   DRFPDGQLYLNLRGFGPAGTPMAAGEAVRTCLDALAVAVDDIPTSLQAQAGLYRSLIAN
FT                   RRMLVVLDNAADAEQVRPLLPASPASMVIITSRRRLESLVATDGAIPLALEVLNAAQAY
FT                   ALLEAGVGAARLAAEPDEVDELIARCAGLPLALRIVLARALTRPGFALAALVSTLRAAQ
FT                   DRLGSFDGGDPVTNLRVVFSWSYRDLPADTAWVFRSLAVHPGPEMSESSIASTSGLSRP
FT                   ATRAALAELVQLHLLQERALGRFSLHDLIRLYAVDHLHGDGDEVIGRARQRLADHYLHS
FT                   AHRAAMLLYPSRDPITIAAPLPGVCLDEFAGELEARAWFGTEHAVLLAVLHDAARHGLH
FT                   AHAWQIPWSMVDYLDWGGHWRDYIATQQIALDASAALGDLNGQIRAHRGLGRAHLRLGD
FT                   IETARGFLTRSLQLSRQSNDPLGEAQTHLILAWMHEQDGDFRSALGHAEQALEGMRAGH
FT                   DGRGVANALNTVGWYHTLLGQHSTALRYCGQALEQHEQLDDPQGHADTWDSLGHAHRGL
FT                   QDLPQAITCYTRAVELYRTIQHGYDEATTQASLAETLLLSGDKDRARATWEHALTLLAP
FT                   LDPDEADAIRSRLTAL"
     gtggagttcg gattgctggg gccgttggcc atttcgcacg agggaagccc gatcaccctg        60
     acgaaggcgg tgccgcgcgc gacactggcc gtgttgctgc tgcaccacgg gcaccccgta       120
     gcggtcgagc ggatcatcga cgtcgtgtgg tcggaggccg atggaccgcc actgaccgcc       180
     aggagcatgg tgcaacgcag cgtgaactct ctgcgggagc tgttcaaggt tgatcccgag       240
     accaccctgc gcacgcgccc cggcggctac gagctgacct gccgcgaggg ggcgcttgac       300
     ctgcggcgtt tcgaggacct ggtcgaccag gctgacgggt gcgggtcgct gcgggagatg       360
     gccgcggtac tgcgtgaggc gctgcggctg tggcgagggg atccgctgtc cgatgtcacc       420
     aaccgcgggc tcgagtcgtt caagacgggc ctgaccgagc ggcgcctcac cgtagtcgaa       480
     cgttgcatcg agctcgaact gcagctaggc cgccatcagg agatcgtcgc cgagctgcag       540
     tcgtggaccg acacgcatcc gttccgggag agcttgctgg cgcttctgat gctcgcgctg       600
     catcgcggcg gtcgcactac cgacgcgttg gccgcttacg cggacttccg cgcgcggctg       660
     gctgaggagg tggggaccga tcccggcact gcggtccgca tgttgcacga gcggatcctc       720
     aacaacgacc acacgctcgc cgcgccggtg caacgaggcg tcgacacggc gataccccaa       780
     acggcgaccg accatgccga cacgccttca cagcctgcct gggtagtccc tcgtcagctt       840
     ccggcggggc cgcgctggct ggtgggccga gacgagcaac tggcccaact cggtcaggcg       900
     ctcgcggccc gcgagactgg tcagatggcg ggcgcgggca ctccggtcgt cgtcgtcgtc       960
     gacgggatgg cggggatcgg taagaccgct ctcgcgctga cgttcgccca ccaggtcagc      1020
     gaccggttcc cggatgggca gctgtatctg aacctgcgcg ggttcggccc ggctggcaca      1080
     ccgatggccg ccggtgaggc cgttcgcaca tgtctggacg cgctcgcggt cgcggtcgac      1140
     gacattccga cgtcgctaca ggcacaagcc gggctgtacc gcagtcttat cgcgaaccgg      1200
     cggatgctgg tcgtgctcga caacgccgct gacgccgagc aagtacgacc gctgctgccc      1260
     gccagccccg ccagcatggt gatcatcacg agtcggcggc gcttggagag tctggtggcc      1320
     accgacggtg ccatcccgct cgcgctcgag gttctcaacg ccgctcaggc gtatgccttg      1380
     ctcgaggcgg gtgtgggtgc ggcacggctg gccgccgagc ccgacgaagt cgacgagctg      1440
     attgcgcggt gtgcggggct gccgctggcg ctgcggatcg tgctggcacg agcgctgacg      1500
     cggccggggt tcgccctggc cgctctggtg tccacgctgc gcgcggcgca ggaccggctc      1560
     ggctcgttcg acggcggaga cccggtaacg aacctgcgcg tggtgttttc ctggtcctac      1620
     cgcgatctgc ccgccgacac cgcctgggtc ttccgcagcc ttgcggtgca tcccgggccg      1680
     gagatgtcgg agtcgtcgat cgcgagcacg tcaggcctgt cccgccccgc cacgcgcgcg      1740
     gcgctggccg aactcgtgca gctgcaccta ctacaggaac gcgccctagg ccggttcagc      1800
     ctgcacgacc tcatccgcct ctacgccgtg gatcacctgc acggcgacgg cgacgaggtg      1860
     atcggccgcg cacggcagcg cctggccgac cactacctgc actcggcaca tcgcgcggcg      1920
     atgctgctgt atccgagccg ggacccgatc acgatcgcgg caccactgcc aggggtctgc      1980
     ctcgacgaat tcgccggcga acttgaggct cgtgcctggt tcggcacgga gcatgcggta      2040
     ctgctcgctg tgctgcacga cgccgcccgg cacggcctgc acgcccacgc ctggcagatc      2100
     ccgtggtcga tggtggacta cctcgactgg ggcgggcact ggcgcgacta catcgcaacc      2160
     cagcagatcg cgctggacgc ctcagctgca ctcggcgacc tcaacggcca gatccgcgcg      2220
     catcgaggcc tgggacgtgc gcacttgcgg ctcggcgaca tcgagaccgc ccgaggattc      2280
     ctgacccgct cgctgcagct gtcgcggcag agcaacgacc cgctgggtga ggcgcaaacc      2340
     cacctgatcc tggcgtggat gcacgagcag gacggtgatt tccgttcagc gttgggtcac      2400
     gccgagcagg ccctggaggg gatgcgcgcg gggcatgacg gcaggggagt agccaacgcg      2460
     ctcaacacag tgggctggta ccacaccctg ctcggccagc acagcacggc gctgcggtac      2520
     tgcgggcagg cattggagca gcacgagcag ctcgacgacc cgcaaggcca cgccgacacc      2580
     tgggacagcc tcggccacgc ccatcgcggc ctgcaggacc tgccacaggc gattacctgc      2640
     tacacccgtg ccgtcgagtt gtatcgcacg atccagcacg gctacgacga agccaccact      2700
     caggcaagcc tggccgagac gctgctgctg tccggtgaca aggaccgtgc ccgggccacc      2760
     tgggaacatg cgctcaccct gctggccccg ctggacccgg acgaggccga cgccatccgc      2820
     tcacgcttga cggccctgta a                                                2841
//

If you have problems or comments...

PBIL Back to PBIL home page