(data stored in ACNUC7421 zone)

EMBL: CP001630.PE569

CP001630.PE569       Location/Qualifiers
FT   CDS_pept        636814..637278
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0577"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: xcv:XCV0585 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0577"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34543"
FT                   /db_xref="UniProtKB/TrEMBL:C6WJB1"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACU34543.1"
FT                   /translation="MNTLYRLITATATGIGLAVLAGASATATAATPADGPAAPTTTSAA
FT                   AQFEMALAPSQTRQLPAGLAVPDATVTAEGIGVLAQGGFDRDHWWIKISKAEVIAIGAN
FT                   AVCRAVFRTAGGVVCPPIVAAVNWLVAQFPNAGGFWAELYTNGRVRAGTW"
     atgaacacgc tgtaccgact catcaccgcc accgccaccg gcatcgggct ggcggtgctg        60
     gccggcgcct cggcgaccgc caccgccgct accccggccg acggacccgc cgcgccgact       120
     accacctcgg cggccgcgca gttcgagatg gccctggcgc cgtcgcagac gaggcagctg       180
     cccgccggcc tggccgtccc cgacgccacg gtgaccgccg agggcatcgg cgtgctggcg       240
     cagggcggct tcgaccgcga ccactggtgg atcaagatca gcaaggcgga ggtgatcgcg       300
     atcggcgcca acgccgtgtg ccgcgcggtg ttccgtaccg cgggaggcgt cgtgtgcccg       360
     ccgatcgtcg cggcggtcaa ctggctggtc gcgcagttcc cgaacgcggg cggcttctgg       420
     gccgagctct acaccaacgg ccgcgtgcgc gcgggcacct ggtaa                       465
//

If you have problems or comments...

PBIL Back to PBIL home page