(data stored in ACNUC7421 zone)

EMBL: CP001630.PE57

CP001630.PE57        Location/Qualifiers
FT   CDS_pept        complement(65703..68078)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0057"
FT                   /product="glycosyl transferase group 1"
FT                   /note="PFAM: glycosyl transferase group 1; KEGG:
FT                   xcb:XC_3634 glycosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0057"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34031"
FT                   /db_xref="GOA:C6WDN6"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="UniProtKB/TrEMBL:C6WDN6"
FT                   /inference="protein motif:PFAM:PF00534"
FT                   /protein_id="ACU34031.1"
FT                   /translation="MNTPVACTATAESGLPSALVLARSYLAHHPGHRFTIAVLDGEDGG
FT                   RRGSDGVTVIGPDLIGPSRDEFLGLATAHPLPQLVDAVKPWLMRGQLRNASRVTWFSPT
FT                   SFVTAPIGEQRGTVVAPHLLRPLTGEAAESAEARLIGTGVLNPGYLSTDDESLLDAWVE
FT                   AVAAFRAVRFDRDALSDQDWFDQALSLVPHEVSTDPGLVLTAWNAFERPGVEPKVVDLL
FT                   GFEPRAPWVLSSLLLDRPAALLSERPDLVPLVREYADLLIAAGHLDEEEVLPTWLDELP
FT                   DGTPLTPLLRGTYRAAVLASTDPRRAKRPAAPPHAFTGAEFRDWLNGPGELGGTTRFTR
FT                   AVWDSRPDLQAVFGRPVHPGFAHWCRESAPAEGVLPAWAVPVPDDPPSAPQDRLGVNLL
FT                   GHLTAVLGVGELGRVLNSALSRSGLDVAPVVEEAMVVNRTDVDRPEESAPVYPVSVLCV
FT                   NADLVRAVSEQHPQVVHERYRIGVWSWELEEFPEAMREFDCVDEVWTISEYCRAAIAPH
FT                   TDKPVRVFPIPIRERPAVEFRAGGPVRFLFAMDFNSLVERKNPFGAVEAFRRAFPDRED
FT                   VELVVKVINGERHVAGLERLRSAAAGDPRVTLLERYLTAEELHDLYAGSDCYVSLHRAE
FT                   GFGFTVAEAMAMGLPVITTDYSGTAEFVDRENCWLVPAEPVPVGPGSPPYPADALWADP
FT                   DLDVAAAAMREVADDPARAAERGLAAREHLRRTRGEDAAAEWVRDRVEQAHRTWRERRA
FT                   PAQAQAAPEAKPQLVVPLLRKVAVRALGRYDSARHRDR"
     atgaacacgc cggtcgcctg caccgccacc gccgagagcg gactgccgtc cgcgctggtg        60
     ctcgcgaggt cctacctcgc ccaccacccc ggccaccggt tcaccatcgc cgtgctggac       120
     ggcgaggacg gtggcaggcg cggctcggac ggcgtcaccg tcatcggccc cgacctgatc       180
     ggcccgtcca gggacgagtt cctgggcctg gccaccgcgc acccgctgcc gcagctggtc       240
     gacgcggtca agccgtggct catgcgcggg cagctcagga acgcctccag ggtcacctgg       300
     ttcagcccca cctcgttcgt caccgccccg atcggcgagc agcgcggcac cgtcgtcgcc       360
     ccgcacctgc tgcgcccgct gaccggcgag gccgccgagt cggccgaggc gcgcctgatc       420
     ggcaccggcg tgctcaaccc cggctacctg tccaccgacg acgagtccct gctggacgcc       480
     tgggtcgagg cggtcgccgc gttccgggcc gtccggttcg accgggacgc gctgagcgac       540
     caggactggt tcgaccaggc gctgtccctc gtcccgcacg aggtctccac cgaccccgga       600
     ttggtgctga cggcgtggaa cgccttcgag cgccccggag tcgaaccgaa ggtggtggac       660
     ctcctcggct tcgaaccgcg cgccccgtgg gtgctcagct cgctgctgct cgaccgcccc       720
     gccgcgctgc tgtccgagcg ccccgacctg gtcccgctcg tgcgcgagta cgccgacctg       780
     ctgatcgcgg ccgggcacct ggacgaggag gaggtgctgc cgacctggct ggacgagctg       840
     cccgacggca cccccctcac cccgctgctg cgcgggacct accgggccgc cgtgctcgcc       900
     tccaccgacc cgcgccgcgc caagcgcccc gccgcgccgc cgcacgcgtt caccggcgcg       960
     gagttccggg actggctcaa cggccccggc gagctgggcg gcaccacccg cttcaccagg      1020
     gccgtgtggg acagccgccc cgacctgcag gccgtgttcg gcaggccggt gcaccccggc      1080
     ttcgcgcact ggtgccgcga gtccgcgccc gccgagggcg tgctgcccgc gtgggccgtc      1140
     cccgtgccgg acgacccgcc gtcggcgccg caggaccggc tcggcgtgaa cctgctcggc      1200
     cacctgaccg ccgtgctcgg cgtcggcgag ctgggccggg tgctgaactc ggcgctgtcc      1260
     cggtccgggc tggacgtggc gcccgtggtc gaggaggcga tggtggtcaa ccggaccgac      1320
     gtcgaccgcc ccgaggagag cgcgccggtg tacccggtga gcgtgctgtg cgtgaacgcc      1380
     gacctggtgc gcgcggtgtc cgagcagcac ccgcaggtgg tgcacgagcg ctaccggatc      1440
     ggcgtgtggt cgtgggagct ggaggagttc cccgaggcga tgcgcgagtt cgactgcgtc      1500
     gacgaggtgt ggaccatcag cgagtactgc cgcgccgcga tcgccccgca caccgacaag      1560
     ccggtgcggg tgttcccgat cccgatccgc gagcgccccg ccgtggagtt ccgcgcgggc      1620
     gggccggtgc ggttcctgtt cgccatggac ttcaactcgc tggtggagcg gaagaacccg      1680
     ttcggcgccg tcgaggcgtt ccgccgggcg ttcccggacc gcgaggacgt cgaactggtc      1740
     gtgaaggtga tcaacggcga gcggcacgtg gccgggctgg agcggttgcg ctccgccgcc      1800
     gcgggtgacc cgagggtgac gctgcttgag cgctacctca cggccgagga gttgcacgac      1860
     ctctacgccg ggagcgactg ctacgtttct ctccaccgcg cggagggctt cggcttcacc      1920
     gtcgcggagg cgatggcgat gggcttgccg gtgatcacca ccgactactc gggcaccgcc      1980
     gagttcgtcg accgggagaa ctgctggctc gtgcccgccg aaccggttcc ggtcggtccc      2040
     ggctccccgc cctacccggc ggacgcgctg tgggccgacc cggacctgga cgtggcggcg      2100
     gcggccatgc gcgaggtcgc cgacgacccc gcgcgcgcgg ccgagcgcgg cctggccgcc      2160
     cgcgagcacc tgcgccgcac caggggcgag gacgccgccg cggagtgggt gcgcgaccgg      2220
     gtcgagcagg cgcaccggac gtggcgggag cggagggccc cggcgcaggc gcaggcggcc      2280
     cccgaggcaa agcctcagct ggtggtcccg ctgctgcgca aggtcgcggt gcgggcgctg      2340
     ggccggtacg acagcgcgcg ccaccgggac cggtga                                2376
//

If you have problems or comments...

PBIL Back to PBIL home page