(data stored in ACNUC7421 zone)

EMBL: CP001630.PE570

CP001630.PE570       Location/Qualifiers
FT   CDS_pept        637607..637975
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0578"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0578"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34544"
FT                   /db_xref="UniProtKB/TrEMBL:C6WJB2"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACU34544.1"
FT                   /translation="MDGTNVFGDDVPELIDPRLLGADDEDRTLRAGATYVPGRYQDGRT
FT                   DIVDVEVVPTNDGHNVILAYSSLPRLVECMGEQQPWVELPATIDPASLQLGTGADMVLW
FT                   DQELPQELRREDGAHGQR"
     atggacggaa caaacgtgtt cggcgatgac gtgcccgaac tcatcgatcc gcgcctactc        60
     ggcgcagacg acgaggaccg aacattgcgc gcgggcgcga cctacgtgcc gggccgatac       120
     caggacggcc gcacggacat cgtcgacgtg gaggtcgtgc cgaccaacga cgggcacaac       180
     gtgatcctgg cctactcgtc gctgccacgc ctggtcgagt gcatgggcga gcagcagccg       240
     tgggtggagc tgcccgcgac catcgacccc gcctcgttgc agctgggcac gggcgccgac       300
     atggtgctgt gggatcagga actgccccag gagctgcgcc gcgaggacgg tgcacatgga       360
     cagcggtaa                                                               369
//

If you have problems or comments...

PBIL Back to PBIL home page