(data stored in ACNUC7421 zone)

EMBL: CP001630.PE571

CP001630.PE571       Location/Qualifiers
FT   CDS_pept        637962..638327
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0579"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0579"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34545"
FT                   /db_xref="InterPro:IPR036689"
FT                   /db_xref="UniProtKB/TrEMBL:C6WJB3"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACU34545.1"
FT                   /translation="MDSGKFRVDLDELRPIGRLLADAQQDLREQCERMPHQVTDAGRST
FT                   AALDAALVALLGGAAELLSSLGSAHDSLSGTYEEYRDTEDRNVIGQQRLAGLDALFTPT
FT                   RHPWAGNTAGHPSTEHP"
     atggacagcg gtaagttccg cgtcgacctc gacgagctgc gcccgatcgg gcggttattg        60
     gccgacgccc agcaggacct gcgcgagcag tgcgaacgca tgccccatca ggtcaccgac       120
     gccgggaggt cgaccgcggc gctcgacgcc gccctggtag ccctgctcgg cggcgccgcc       180
     gagctcctca gcagcctggg cagcgctcac gactcgctga gcggcaccta cgaggagtac       240
     cgcgacaccg aggaccgcaa cgtgatcgga cagcagcggc tggccggcct cgacgcgctg       300
     ttcaccccca cccgacaccc gtgggccggc aacaccgccg gtcacccctc gacggagcac       360
     ccgtga                                                                  366
//

If you have problems or comments...

PBIL Back to PBIL home page