(data stored in ACNUC7421 zone)

EMBL: CP001630.PE572

CP001630.PE572       Location/Qualifiers
FT   CDS_pept        638324..639445
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0580"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0580"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34546"
FT                   /db_xref="UniProtKB/TrEMBL:C6WJB4"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACU34546.1"
FT                   /translation="MIAPISGPQMPLPQPPRPIMGGHTLATRVDGDIRQLWDKIAWLTG
FT                   VAFEIARVQDTLHAARAASLQAWDGRAADRARDKLGRDGATAGDLAAAARRVVQALTVF
FT                   VYELEAVVESMAQARDLARSAGYRLTADTIQFPLPIVDPAATGPGRTITALVTAARRKE
FT                   AAAHQAIQTDVAKEKTFFEAFLTPTRMLGVARGVFTTSMVTYLAKPAPAVGQFTAAELT
FT                   ARLNTAVAFADNTTGGLRHTALSQAFDLAPRIPAAELNAPLTLGPARLVGNDMPYAKAV
FT                   LKPLHVPGGVLGLAGTGLSIMHGTPPTTAAAAGAGGWAAGAAASGLTEVLLTAATAARF
FT                   GALAAGPIGWAAFVVGTAVSAGVGYAIEHHWSD"
     gtgatcgcac caatcagtgg cccgcagatg ccactgcccc agccgccccg gccgatcatg        60
     ggcggacaca ccctggcgac cagggtggac ggcgacatca ggcagctctg ggacaagatc       120
     gcctggctga ctggggtggc cttcgagatc gcgcgagtgc aggacaccct gcacgccgcc       180
     cgcgcggcct cactacaagc ctgggacggc cgggccgccg accgcgcccg cgacaagctc       240
     ggccgcgacg gcgccaccgc aggggatctc gccgccgcgg cgcggcgcgt agtgcaggcg       300
     ctcacggtct tcgtctacga actcgaggca gtcgtcgagt ccatggcgca ggcgcgcgac       360
     ctggcccgct cggccggcta ccggctcacc gccgacacta tccagttccc gctgccgatt       420
     gtggatcccg cggctaccgg tcccggccgg accatcacag cgctggtcac cgcggcccgg       480
     cgcaaggaag ccgcggcgca ccaggcaata caaaccgacg tggccaagga gaagaccttc       540
     ttcgaggctt tcctcacccc gacacggatg ctcggggtgg cccggggcgt gttcaccacc       600
     tcgatggtca cctatctggc caagcccgcg cccgccgtgg gccagttcac tgcggccgag       660
     ctcaccgcgc gcctcaacac cgcggtggcc ttcgccgaca acacaaccgg cgggctgcgc       720
     cacaccgcgc tcagccaggc attcgatctg gcgccgcgca tccccgctgc cgagctcaac       780
     gcaccactca cgctcggccc cgcaaggctg gtcggcaatg acatgccgta cgccaaggct       840
     gtcctcaagc cgctgcacgt gcccggcggt gtcctgggcc tcgccgggac cggcctgtcg       900
     atcatgcacg gcacgccgcc gaccacagcg gcggccgcag gggcgggcgg ctgggcggcc       960
     ggcgctgccg ccagcggcct caccgaggtg ctcctcacgg ctgcgacagc cgcacgattt      1020
     ggagccctgg ccgccggacc gatcggctgg gccgccttcg tagtcgggac cgcggtcagc      1080
     gcgggcgtgg gctacgccat cgagcaccac tggagcgact ga                         1122
//

If you have problems or comments...

PBIL Back to PBIL home page