(data stored in ACNUC7421 zone)

EMBL: CP001630.PE573

CP001630.PE573       Location/Qualifiers
FT   CDS_pept        640633..641100
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0581"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: pca:Pcar_0786 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0581"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34547"
FT                   /db_xref="UniProtKB/TrEMBL:C6WJB5"
FT                   /inference="similar to AA sequence:KEGG:Pcar_0786"
FT                   /protein_id="ACU34547.1"
FT                   /translation="MTENRAAKREIRELQQITGLSYTEITRLKRVFDEVLEREPHLNLN
FT                   GFGLSWFGTQTLAERREQARAWRDELRRSAADVIEVCQWLRENIRPIKTPQQRSYGLKH
FT                   LVEQNIGKYVSNGELIAAALMAGYPMGPIDGPNTVFGMSQRDVNRLRAGAR"
     atgaccgaga accgcgcagc caagcgtgag atccgggagt tgcagcagat cacgggcctt        60
     tcctacaccg agatcacgcg gttgaagcgc gtgttcgacg aagtgctgga acgggaaccg       120
     catctcaacc tgaacgggtt cggactgtca tggtttggca ctcagacttt ggcggaacgg       180
     cgggaacagg cccgtgcctg gcgggatgag ttgcggcgat cggcagccga tgtgatcgag       240
     gtgtgccagt ggctgcgaga gaacatccgg ccgatcaaaa cgccgcagca gcgcagctac       300
     gggttgaagc acctggtgga acagaacatc ggcaagtacg tgtccaacgg tgaactgatc       360
     gccgcggcgc tcatggccgg ctaccccatg ggaccgattg acggtcccaa cacggtgttc       420
     ggaatgagcc agcgggatgt gaaccgcctc cgcgccggcg cccgctga                    468
//

If you have problems or comments...

PBIL Back to PBIL home page