(data stored in ACNUC7421 zone)

EMBL: CP001630.PE574

CP001630.PE574       Location/Qualifiers
FT   CDS_pept        641901..642743
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0583"
FT                   /product="transposase IS4 family protein"
FT                   /note="PFAM: transposase IS4 family protein; KEGG: similar
FT                   to F57G4.9"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0583"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34548"
FT                   /db_xref="InterPro:IPR027805"
FT                   /db_xref="InterPro:IPR027806"
FT                   /db_xref="UniProtKB/TrEMBL:C6W8S8"
FT                   /inference="protein motif:PFAM:PF01609"
FT                   /protein_id="ACU34548.1"
FT                   /translation="MAKPLVAELSTKKVLHRQGLHVLFYRAALPLSHQTLTFVSGLVRA
FT                   HRKQLGSVWRKLNPGQQALLVLVYLRKGETFADLAAGFAVSTSTCWRYVNETVELLAQR
FT                   SPKLREALRKAKRQGMAHVVIDGTLIPIDRIAADRPFYSGKHKIHGVNLQVIASPDGTI
FT                   LWVSGDLPGSTHDTAAARIWNILAALRHAGLIALGDKGYHAYDPTDRHVITPYKGRNKP
FT                   ESQKDANRAHARLRGPGERANAQLKTWRILRKLRCCPRRAGRLAKAIHVLQNYEATTG"
     atggcgaagc ccctggtagc agagctatcg accaagaaag ttctgcaccg ccaggggctt        60
     cacgtgctgt tctaccgtgc cgcgctgccg ttgtcacatc agaccctgac cttcgtgtcc       120
     gggctggtcc gcgcccaccg caagcagctc ggatcggtgt ggcgcaagct caacccagga       180
     caacaagccc tgctggtgct ggtgtacctg cgcaaaggcg agaccttcgc cgatctcgcc       240
     gccgggttcg cggtctcgac ctccacctgc tggcgctatg tcaacgagac cgtcgaactg       300
     ctcgcccagc ggtccccgaa gctccgagaa gcgctgcgca aggcgaaacg ccagggcatg       360
     gcccacgtgg tgatcgacgg cacgctcatc ccgatcgacc ggatcgccgc cgaccgcccc       420
     ttctactccg gcaagcacaa gatccatgga gtgaacctgc aggtgatcgc gtccccggac       480
     ggcacgatcc tgtgggtgtc cggcgacttg cccggcagca cccacgacac cgccgccgcc       540
     cggatctgga acatcctcgc cgccctgcgc cacgccgggc tgatcgccct gggcgacaag       600
     ggctaccacg cctacgaccc gaccgaccgc cacgtgatca ccccttacaa gggccgcaac       660
     aaacctgaat cacagaagga cgccaaccgc gcccatgccc gcctgcgcgg ccccggcgaa       720
     cgcgccaacg cccagctcaa gacctggcgc atcctccgca aactccgctg ctgcccccgc       780
     cgcgccggcc gactggccaa agccatccac gtcctacaga actacgaggc caccacagga       840
     tga                                                                     843
//

If you have problems or comments...

PBIL Back to PBIL home page