(data stored in ACNUC7421 zone)

EMBL: CP001630.PE576

CP001630.PE576       Location/Qualifiers
FT   CDS_pept        complement(642843..643604)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0585"
FT                   /product="transposase IS4 family protein"
FT                   /note="PFAM: transposase IS4 family protein; KEGG: similar
FT                   to F57G4.9"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0585"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34550"
FT                   /db_xref="InterPro:IPR027805"
FT                   /db_xref="InterPro:IPR027806"
FT                   /db_xref="UniProtKB/TrEMBL:C6WJB8"
FT                   /inference="protein motif:PFAM:PF01609"
FT                   /protein_id="ACU34550.1"
FT                   /translation="MLVYPSAIDLSSSHLQFLARELTTHRRRIGSRWRRLDPGRQALLV
FT                   LAHLRCGDTYTRLAVGFGVGLATVCRYIHEAVELLAALAPDLADAAKVASRKAYVILDG
FT                   TLLLIDRVAADRPYYSGKHKRHGMNVQVLADPAGRLLRVSPALPGSVHDLTAARIHGIV
FT                   DALAAADIPCWADKAYRGAGGPVRVPYRGKWHNLSPGQQAVNRSHARIRAPGERAVSTL
FT                   KTWRLLRRLRCSTTHITNLTRAVLTLHLNAG"
     gtgcttgtct acccatccgc gatcgacctg tccagttcac accttcagtt cctggcacgg        60
     gaactgacca cgcaccggcg ccggatcggc agcaggtggc gcaggctcga ccccggccgc       120
     caagccctgc tggtcctggc gcacctgcgc tgcggcgaca cctacacacg actggccgtc       180
     ggattcggcg tcggtctggc caccgtctgc cgctacatcc acgaagcggt cgaactcctg       240
     gccgcactgg caccggacct ggccgacgcg gcgaaagtcg cctcacgcaa ggcctacgtc       300
     atcctcgacg gcaccctgtt actcatcgac cgcgtcgccg ccgaccggcc gtactactcc       360
     gggaagcaca agcggcacgg catgaacgtc caggtcctcg ccgatccggc cgggcgactg       420
     ctccgggtct cgcccgcgct gccgggctcg gtccacgatc tgaccgcggc tcgcattcac       480
     ggcatcgtcg acgccctggc cgcagcggac atcccgtgct gggcggacaa ggcctaccgg       540
     ggcgccggcg gcccggtccg cgtcccctac cgaggcaagt ggcacaactt gtcaccgggg       600
     cagcaggcgg tcaaccgctc ccacgcccgt atccgcgccc cgggtgaacg cgccgtctcc       660
     accctcaaga cctggcggct actgcgcaga ctccgctgct ccaccaccca catcaccaac       720
     ctgaccagag ccgtcctcac actccacctc aacgccggat ga                          762
//

If you have problems or comments...

PBIL Back to PBIL home page