(data stored in ACNUC7421 zone)

EMBL: CP001630.PE577

CP001630.PE577       Location/Qualifiers
FT   CDS_pept        complement(643644..644723)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0586"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0586"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34551"
FT                   /db_xref="UniProtKB/TrEMBL:C6WJB9"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACU34551.1"
FT                   /translation="MPLLNEMPLERANQIFRHPIHQEGVSTLERLITALRQCRSAEDFY
FT                   DFQQDLLARVLEVQEHRAACRRVAKLLRQGKAVPADAPELRSADPATSPETWDLEADVC
FT                   ERVDRQLRSVADGLAWRVFSYDRRVIIALSRNQHPGPMAGKKGLAAERAFVIDWWRDEG
FT                   RFVLLHDLTSCLTIGDATSFKEIGNEYEAYLHEIKSDPNRIVSRQARRQRMAEEAIRSG
FT                   GQLPGDLPGRLVPLDIPYKTHLNLLGTAFDLARDRGVQGMKVPGGRALVASDIVRGYDL
FT                   WSEREFIDRTAAEHLQAVKRARILDVGHLVWARSDDLVARSPTMPPWSIYPLSPSLSPF
FT                   QPGVVGLRSCWRRGEAPGR"
     atgccgctgc tcaacgagat gccgctcgag cgagcgaatc agatcttcag acacccgatt        60
     catcaggaag gggtcagcac cctggagcgc ctgatcaccg cgctgcggca atgtcggagt       120
     gccgaggact tctacgactt ccagcaggac ctgttggcgc gagtgctgga ggttcaggaa       180
     catcgggcag cgtgtcgacg cgtcgcaaag ctgctccggc agggcaaggc cgtgccggcc       240
     gacgcccccg agctgaggtc cgcagacccg gcaaccagcc cagagacctg ggaccttgag       300
     gcggatgtct gcgagcgggt cgaccgtcag ctgcggtcgg tagctgatgg tctggcctgg       360
     cgcgtgttca gctacgaccg gcgagtcatc atcgcgctct cccgcaatca gcatcctggg       420
     ccgatggctg gcaagaaggg cttggccgcc gaacgcgcgt tcgtgatcga ctggtggcgt       480
     gacgaagggc ggttcgtcct actgcacgac ctcacatcgt gcctgaccat cggggacgcc       540
     acctcgttca aggagatcgg caacgagtac gaggcatacc tgcatgagat caaatccgat       600
     cccaaccgca ttgtttcccg gcaagcgcgc cgccagcgga tggccgagga agcgatccgc       660
     tccggcgggc agttgcccgg cgatctgcct ggccgactgg tgccgctcga catcccgtac       720
     aagacgcacc tcaacctgct gggcacagcc ttcgacctcg cgcgcgaccg tggcgtccag       780
     gggatgaagg ttcccggcgg tcgtgcgttg gtagcgagcg acatcgtgcg cggttacgac       840
     ttgtggtcag aacgtgaatt catcgaccgg acggccgccg agcacctcca agccgtgaaa       900
     cgggctcgta tccttgatgt cgggcacctc gtctgggcgc gaagcgatga cctcgtggcg       960
     cgctcgccaa cgatgcctcc gtggtcgatc tatccgctat caccttcact gagccctttc      1020
     caacctggcg tggtggggct gcggtcgtgc tggagacgtg gcgaagctcc tggtagatga      1080
//

If you have problems or comments...

PBIL Back to PBIL home page