(data stored in ACNUC7421 zone)

EMBL: CP001630.PE578

CP001630.PE578       Location/Qualifiers
FT   CDS_pept        645528..646220
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0588"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: ppr:PBPRA2228 putative carboxynorspermidine
FT                   decarboxylase"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0588"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34552"
FT                   /db_xref="UniProtKB/TrEMBL:C6WJC0"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACU34552.1"
FT                   /translation="MQIVDGLTYNGATRLKKRSMLPNAAGIYIWTLQLGHHLTRAEMSA
FT                   DLMVEAISAPFKQVRENRFDSGKLGHYRRVQLYDEPASLSPSSMARLAALLDGGSAELS
FT                   WSLMCATLFQRPLYVGKALNFRDRLPCHFGYKSKFSRLLREHGMSVNDCAVVLCPVTID
FT                   GLAADEDDDRDDLTDSVEGVPPLMEDGDDLEPEEYVPPGKAELNNVIQFAESLVIRTSH
FT                   PLFNERMD"
     gtgcagattg tcgacggctt gacatacaac ggcgcgacgc ggctgaagaa gcgcagcatg        60
     ttgccgaacg cggcgggcat ctacatctgg actctgcagc ttggccatca tttgacgcgc       120
     gccgagatga gcgccgattt gatggtggaa gctatttcgg cgccgttcaa gcaggttcga       180
     gagaatcggt tcgatagcgg aaagctcggc cactacagac gggtccagtt atacgacgaa       240
     cctgcctctc tctcgccgtc gtcgatggcc cggctggccg cgcttctgga tggcggttct       300
     gcggagctgt cgtggtcgct catgtgcgcg actctgtttc agaggccgtt gtacgtcggt       360
     aaggcactga acttccgcga tcggcttccc tgtcacttcg gttacaagtc caagttttcg       420
     aggctgttgc gtgagcacgg aatgtccgtg aatgactgtg ccgttgtgtt gtgcccggtg       480
     acgatcgacg gacttgctgc ggatgaagac gacgaccgcg acgatctgac cgactccgtt       540
     gagggcgtcc cgcctctgat ggaggacggt gacgatcttg agcccgagga gtacgtaccg       600
     ccgggcaagg cggagttgaa taacgtgatt caattcgctg agtccttggt catccgcacc       660
     agccatccgc tgtttaacga gagaatggac tga                                    693
//

If you have problems or comments...

PBIL Back to PBIL home page