(data stored in ACNUC7421 zone)

EMBL: CP001630.PE579

CP001630.PE579       Location/Qualifiers
FT   CDS_pept        646222..648237
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0589"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0589"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34553"
FT                   /db_xref="InterPro:IPR017642"
FT                   /db_xref="UniProtKB/TrEMBL:C6WJC1"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACU34553.1"
FT                   /translation="MTALSKFGGAAAPAWTSDFQFVRGEYAIGGEQVPYFCTTMKVEEA
FT                   RKYLNLARELAVDPADPINIEELMQRDIDSDRANSEIAEYLKQPARIKFFNSLTIVLVP
FT                   VEKDGRSKKAFDENVPLPQDLVTEDFDVIQAGPVVARLLTGTNVGYLRWQPEHVRAIII
FT                   DGQHRFMALNAVHDEQPTTLKPHVTSIPVLILVLDSRAGFVPPAGGPSEITTASRSIFT
FT                   DLNKHAVKVTPEREYLLDDRSVTAVCMRALITPGLRSEELPSTASWPAQIPLAAVDWVR
FT                   TNRSKFDDGFSITTLQVLHQLVDDVVDSRKPSASTDYEAMKAWTDQLTARLELEAVPGW
FT                   SVDALDTRLKTDELEEAPFALLNSEVKAAALGFRDSVGKVITAVLLAGLPYAELLSRYR
FT                   EVGLLGGTQELWLGQGTEGRNAYKAAYAEDPSPAASQIAAEVKGRYRLAYQVVFQRGFV
FT                   LAAREIDSNRAVLAPLWNVDSGSREDLLAAWILRFNNLARQTLTREGLWTGAAVNSDGT
FT                   IDYTQVSKTAIMGLVVLATTMGLPVGESGGAEQSNDDIRAMLRPSSSGDAVLLAADPFA
FT                   LAEANEIHVAGARRWLQALALGSRRQDGTAPLLRAAASAYRKGVRRYVLGLSKVDGRVL
FT                   TKESLEKMIKIHGARRLAHFAELLAPAADSVPIAES"
     atgaccgcgc tgagcaagtt cggcggggcc gccgcgcccg cttggacgag cgactttcag        60
     tttgtgcgcg gcgagtacgc tattggcggc gagcaagtgc cgtacttctg caccactatg       120
     aaggtggagg aagcgcggaa gtacctgaat ctcgctcggg agctcgccgt tgatccggct       180
     gacccaatca acatcgagga gttgatgcaa cgcgacatcg actctgatcg tgcgaactcc       240
     gagatcgccg agtatctgaa gcaaccggcg cggatcaagt tcttcaactc cttgacgatc       300
     gttcttgtcc cggtggaaaa ggacggccgg tcgaagaagg cgttcgacga gaacgttcca       360
     ctccctcaag acctggtcac tgaggatttc gacgtgatcc aggccggtcc cgtggtggcg       420
     aggctgctca cggggaccaa cgtcggctac ctgcgctggc agcccgagca cgttcgggcg       480
     attatcatcg acgggcagca ccggttcatg gcgctcaacg ccgtgcatga tgagcagccg       540
     acgacgctca agccgcatgt cacgagcatc ccggtgctca tactggtgct ggattcgcga       600
     gcagggttcg tgccgccagc gggcgggccc tcggagatca cgaccgcgag caggtcgatc       660
     ttcaccgatc tgaacaagca cgccgtaaag gtgacgcccg agcgggagta tctgctggac       720
     gaccgtagcg tcaccgctgt gtgtatgagg gcgctgatca ccccaggcct gcgcagcgag       780
     gagctgcctt cgacggcgag ctggccagcg cagattcccc tggcggcggt ggattgggtg       840
     cggactaacc ggtcgaagtt cgacgatggc ttttccatta cgacgctgca ggtgctgcat       900
     cagctggtcg acgatgttgt cgacagccgg aagccatcgg ccagcactga ctacgaggcg       960
     atgaaggcct ggacagacca gctcacggcg cggctggagt tggaggccgt gccgggttgg      1020
     agcgttgacg ctctggatac tcggctgaag acagacgagc tggaggaagc tccgttcgct      1080
     ctgttgaact ccgaagtcaa ggccgctgcc ctgggttttc gtgacagtgt cggaaaggtg      1140
     attacggcag tgctgctcgc agggcttccg tacgcggagc tgctgagcag gtaccgggag      1200
     gtgggcctac tcgggggcac tcaggaactg tggctgggcc agggcaccga aggccgcaac      1260
     gcctacaagg cggcgtatgc agaggatcct tctccggcgg catcccagat cgcggccgag      1320
     gtcaagggac gttatcgcct ggcataccag gtggtctttc agcgcgggtt cgtgctggcg      1380
     gcgcgtgaga tcgacagcaa ccgagctgtc ctcgcgccac tgtggaatgt agacagtggc      1440
     agccgtgagg acctgctagc ggcgtggatt ctccgattca acaatcttgc ccgtcaaacg      1500
     ttgaccagag agggactgtg gacgggcgcc gcggtgaact ccgacgggac catcgactac      1560
     acccaggtgt cgaagaccgc gatcatgggt ttggtagtgc tcgccaccac catgggtcta      1620
     cctgtgggtg agtcaggcgg cgcggagcag tcgaacgacg acatcagggc gatgctgcgg      1680
     ccaagttcgt ccggtgacgc ggtgttgcta gccgctgatc cttttgcgct cgccgaggca      1740
     aatgagatcc atgtcgcggg tgcacgccga tggcttcagg cgctcgcact cggctcacgc      1800
     aggcaggacg gcaccgcgcc gttgctccgc gctgccgcct cggcctacag gaaaggtgtg      1860
     cggcggtatg tgcttggtct gagcaaggtg gatggccggg tactgaccaa ggagtcgctg      1920
     gagaagatga tcaaaattca cggtgcccga cgactggccc acttcgccga gctacttgca      1980
     cccgctgctg actccgtccc cattgccgag tcatag                                2016
//

If you have problems or comments...

PBIL Back to PBIL home page