(data stored in ACNUC7421 zone)

EMBL: CP001630.PE58

CP001630.PE58        Location/Qualifiers
FT   CDS_pept        complement(68337..69401)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0058"
FT                   /product="Methyltransferase type 11"
FT                   /note="PFAM: Methyltransferase type 11; Methyltransferase
FT                   type 12; KEGG: swi:Swit_4011 methyltransferase type 12"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0058"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34032"
FT                   /db_xref="GOA:C6WDN7"
FT                   /db_xref="InterPro:IPR013216"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:C6WDN7"
FT                   /inference="protein motif:PFAM:PF08241"
FT                   /protein_id="ACU34032.1"
FT                   /translation="MALDVLRDTWEKLGGVDPLWAVLTDPGRRDGRWDVEEFMRTGPEA
FT                   VGQVRTLLGERTLGSRVLDFGCGVGRLSNALAAHADRVVGVDIASTMVARARELNRHPD
FT                   RVEFVHYDGRLLPFEDASFDGALSLIVLQHARPWVQIGALLELLRVVRPGGTLVVQIPS
FT                   ARRAPAPMPEEAYRADIEVLEAPSALGVGQSALVRARVTNLSEHPWPGTKTIKLGNHWR
FT                   SGGEVVQLDDGRVGLPAMVAPGESFEVGVPVTAPRAGELVLELDLVHEMVTWWESEGGT
FT                   PARVPITVTASPAPPSEVTPAGEAHPGEQIEMHALHTEFVQALFGHCGAEVVAAVPDEA
FT                   AGEEWESFTYVVSR"
     atggcgctcg acgtgctgcg cgacacctgg gagaagctcg gcggggtcga cccgctgtgg        60
     gccgtgctga ccgaccccgg caggcgggac ggccgctggg acgtcgagga gttcatgcgg       120
     accgggcccg aggccgtcgg ccaggtccgg acgctcctgg gcgagcgcac cctggggtcg       180
     cgggtgctcg acttcggctg cggcgtcggc aggctctcca acgcgctggc cgcgcacgcc       240
     gaccgcgtgg tgggcgtcga catcgcctcc accatggtcg cccgcgcccg cgagctgaac       300
     cggcacccgg accgggtcga gttcgtgcac tacgacgggc ggctgctgcc gttcgaggac       360
     gcctcgttcg acggcgcgct gagcctgatc gtgctccagc acgcccgccc gtgggtgcag       420
     atcggcgcgc tgctggagct gctgcgggtg gtccggccgg gcgggacgct ggtcgtgcag       480
     atcccgagcg cccggcgcgc tcccgcgccg atgcccgagg aggcgtaccg ggcggacatc       540
     gaggtgctgg aggcgccctc ggcgctgggg gtcgggcagt ccgcgctggt gcgggccagg       600
     gtgacgaacc tgagcgagca cccgtggccg ggcaccaaga cgatcaagct gggcaaccac       660
     tggcggtcgg gcggcgaggt cgtgcagctg gacgacggcc gggtcgggct gcccgcgatg       720
     gtcgcgccgg gcgagtcgtt cgaggtcggc gtcccggtca ccgcgccccg cgcgggcgag       780
     ctggtgctgg agctggacct ggtgcacgag atggtgacct ggtgggagag cgagggcggg       840
     acgcccgcgc gcgtcccgat cacggtgacc gcctcacccg cacctccttc ggaggtaacc       900
     ccagcgggtg aagctcaccc cggcgagcag atcgagatgc acgcgctgca caccgagttc       960
     gtgcaggcgc tgttcggcca ctgcggcgcc gaggtcgtcg cggccgtccc ggacgaggcg      1020
     gcgggcgagg agtgggagtc cttcacctac gtggtctcgc gctga                      1065
//

If you have problems or comments...

PBIL Back to PBIL home page