(data stored in ACNUC7421 zone)

EMBL: CP001630.PE580

CP001630.PE580       Location/Qualifiers
FT   CDS_pept        complement(648541..649371)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0590"
FT                   /product="phosphoadenosine phosphosulfate reductase"
FT                   /note="PFAM: phosphoadenosine phosphosulfate reductase;
FT                   KEGG: swi:Swit_5329 phosphoadenosine phosphosulfate
FT                   reductase"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0590"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34554"
FT                   /db_xref="GOA:C6WJC2"
FT                   /db_xref="InterPro:IPR002500"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/TrEMBL:C6WJC2"
FT                   /inference="protein motif:PFAM:PF01507"
FT                   /protein_id="ACU34554.1"
FT                   /translation="MTGANSSKVRHVLGISGGKDSSALAIYMRDRVPDMEYFFCDTGAE
FT                   LPETYEYLNRLEAALGKSIVRLNAARDFDHWMEVYQGTLPSPQMRWCTKNLKIKPLEEW
FT                   VGDDKVISYVAIRADENRLGYVSTKPNIDAVFPFREDGIDKDGVMRILDEAGIGLPGYY
FT                   EWRTRSGCYFCFFQRKHEWVGLKERHPELFDKAVAYEEKVRYRHTAMQGRNYTWSQGES
FT                   LHELIDRKDEIEAKHTAALERASKRIKPNRPLLEVLSDALDTDDDEAGCSVCHL"
     atgacaggcg cgaatagctc gaaggtgcgg cacgtactgg gcatttcggg cgggaaggac        60
     tcctcagctc tggccatcta catgcgagac agggtgccgg atatggagta cttcttctgc       120
     gacaccggtg ccgagctccc agaaacctac gagtacctca atcgcctcga ggcagcactc       180
     ggaaagtcga tcgttcgcct caacgcagcc cgcgacttcg accactggat ggaggtctac       240
     cagggaacac tgcccagccc acagatgcgc tggtgcacaa agaacctcaa gatcaagcca       300
     ttggaagagt gggtcggcga cgacaaggtc atctcctacg tagcgatccg cgccgacgag       360
     aaccggctcg gctacgtcag caccaagccc aacatcgacg cggtcttccc cttccgagag       420
     gacggcatcg acaaggacgg cgtaatgcgc atcctcgacg aagccggcat cggccttccc       480
     ggctactacg agtggcgaac tcgctccggc tgctacttct gcttcttcca gcgcaagcac       540
     gaatgggtcg ggcttaagga acgacacccc gaactgttcg acaaggcggt tgcctacgag       600
     gagaaggtcc gataccgcca caccgcgatg cagggacgca actacacctg gtctcaagga       660
     gagtccctgc acgaactcat cgaccgcaag gacgagattg aagcgaagca tacggctgcc       720
     ttggagcgtg cgtctaagcg gatcaagcca aatcggccac tcctcgaagt gctgtccgac       780
     gcactcgata ccgacgacga tgaggctggt tgttcggtgt gtcatctctg a                831
//

If you have problems or comments...

PBIL Back to PBIL home page