(data stored in ACNUC7421 zone)

EMBL: CP001630.PE581

CP001630.PE581       Location/Qualifiers
FT   CDS_pept        complement(649368..652946)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0591"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: swi:Swit_5328 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0591"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34555"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C6WJC3"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACU34555.1"
FT                   /translation="MTVAAPSPPSRDTRTAIPEFPAGIALVGSQMRSTNLERDVRDALQ
FT                   SPYIGARAVDVLERITSAIADLRRTRAWSFTGPYGSGKSTLSNLIDALLGHDDSRRDEA
FT                   ERILTGTSPALAQRLAAARAERTNTGFLGAVATARREPLVSTLARALETAASRRWGKRA
FT                   PKAIASALANCSHPATTGAKQIMAAITAMTAEQPLLLIIDEFGKTLEHLAGHSEFASPE
FT                   HDLFLLQELAEHCAGPNGLPVYLLTLQHLSFLDYASRTSDLETREWAKIQGRFEDITFL
FT                   PHHGDSLQLLRRRLDHSAVSPAGKALIQVCADAAAREWKEHGLNILAELDSKDFADLYP
FT                   LHPLTAIAAPILAAQIGQHDRSLSGFLNSGEPNTVRDALTAHSRTDAERASTVRLPQLY
FT                   DYFLNAGRTSLLASPNASRWIEIDARIRDANGLPDSDQDLLKTIGVLNLIDADGALSAT
FT                   NEMIHFALRDPDDLVDAAAYAALEEQIADLVRRGFLVYREFSGEYRLWQGTDVDIDGRL
FT                   KEITSHLDEASVIQRLSAYVPSSVVAGRHSQVTGMLRVFVTAVSGPETSHVDAPDEMTE
FT                   PADGLVVFHLGTSTKRPVVDSTLPVVFGTTLNPDIVLSAATHLVALKELQQQALDHVAL
FT                   REVTDRAVQAEATFREIFQAAFYPPATDATWSTWHAGLPADQDPNTAQLMARSLSGLVS
FT                   QVCDEVYSQTPHIRNEMLGRHALTSQAARARSDLLDAMLTSSGKQDLGFPTDKYGPERA
FT                   MYRGVLAYLGLHRQNGAVQAEQTSDSLFPYGFSAPGDKDPERYAKPVWEALQQALTEAT
FT                   ERTSLDHVVRVVMSPPFGVKAGVWPLLVVTALLIRRHDVALFEEGTYLPRLTQDIVERL
FT                   EKVPSRFQVKYTPVSSGQRASVVKKLLVSLKVEPARSQALRNPDMLSVTRALLERVMVL
FT                   NKYARQTKQISSDALAVRKALVGSQDPDDLLFKALPKALGRGPIGPAARADAAAVDEYV
FT                   TRLTAAVDEIAAIDSKLRAKVVETLAHEFRLPSELHELRSTLAARLRGFADVALSAELK
FT                   GFVDFVLSDSLSDEDWLDPIVVRLTNSALGDWDDREAAMFPRRAREMAAALDRVGHLHR
FT                   TTDASAQEENLEAQLLTLTDKAGVEQRTLIYMPARSRAKAENLAADALKRAEKALGPDG
FT                   ARILLAALAQRVAEATTVAPETKEQA"
     gtgaccgtcg ccgccccgtc gccgccctct agggacaccc gcacagccat cccggagttc        60
     cccgccggca ttgcgctggt cggctcccag atgcgctcca ccaaccttga gcgcgacgtc       120
     cgtgatgccc tgcagtcgcc ctacatcggt gcccgggccg tggacgtact ggagcgaatc       180
     accagcgcaa tcgccgacct gcgacgcacc cgcgcctggt cgttcaccgg tccttacggc       240
     tccggcaagt caaccctgtc caatttgatc gacgccttgc tcggccacga tgactcgcgg       300
     cgcgacgaag cggagcgcat tctcaccggc acaagtcccg ccctggcgca acgtctcgcc       360
     gcagcacgtg cggagcggac taacacgggc ttcctcggag ccgtggcaac ggcacgacgt       420
     gaacccctcg tctccaccct ggcacgggcg ttggagaccg cagcctccag gcgatggggc       480
     aagcgtgccc ccaaggccat tgcgtcggct ctcgctaact gctcccatcc cgcgaccacc       540
     ggagcaaagc aaatcatggc cgcgatcacg gccatgaccg ccgagcaacc actgttgttg       600
     atcatcgacg agttcggtaa aacgctcgaa cacctcgccg ggcacagcga gttcgccagt       660
     cccgagcacg acctgtttct ccttcaagaa cttgccgagc actgcgccgg ccccaacggg       720
     ctacccgtgt acttgctaac cctgcagcat ttgtcctttt tggactatgc gtcccggaca       780
     agcgacctag agacccgcga gtgggccaag atccagggac gattcgaaga catcaccttc       840
     cttccgcacc acggcgactc cctgcaactg ctacgccgac ggctcgacca ctctgccgtc       900
     agtccggccg gcaaagcgct gatccaggtg tgtgcggatg ctgcagcccg tgaatggaaa       960
     gaacatggcc taaacatcct cgccgagctc gacagcaagg atttcgccga cctctatcca      1020
     ctgcacccgc tgaccgcgat cgccgcaccc atcctcgccg ctcagatcgg ccagcacgac      1080
     cgcagcctgt caggattcct caacagtggc gagcccaaca ctgtccgcga cgccctgacc      1140
     gcccactccc ggaccgacgc tgaacgcgcc agcaccgtac gacttccaca gctgtacgat      1200
     tacttcctca atgccggtcg cacctccctg ctcgcatccc cgaacgcgag ccgctggatc      1260
     gaaatcgacg cacgcatcag ggacgccaat gggcttccag actctgacca ggacttgctg      1320
     aaaaccattg gtgtgctgaa cctgatcgac gccgatggcg ccctcagtgc caccaacgaa      1380
     atgatccatt tcgctctgcg tgacccagat gatctcgtcg acgcagccgc gtacgccgcc      1440
     ctggaagaac agattgccga tctcgttcgg cgaggcttcc tcgtctaccg cgaattcagc      1500
     ggtgagtacc gcttgtggca gggcaccgac gtcgacatcg acgggcggct caaggagatc      1560
     accagtcatc tcgacgaagc gtcggtgatt cagcggttga gcgcctatgt cccctcttca      1620
     gttgtcgcgg gccgccacag ccaggtgact gggatgctgc gcgtgttcgt taccgccgtc      1680
     agcggaccgg agacgagcca cgtcgacgcg cccgacgaga tgaccgaacc ggccgacggt      1740
     ctcgtggtct tccacctcgg cacttcgacg aagcgacccg tcgtggactc gacactgccc      1800
     gtcgtgttcg gtacaaccct caaccctgac atcgtgctca gcgcggccac gcatctcgtt      1860
     gcactcaaag agctccagca gcaggcgctc gatcatgtag cactcaggga agtcacggat      1920
     cgtgccgtcc aggccgaagc cacattccga gagatcttcc aagcggcgtt ctacccaccg      1980
     gcgactgacg ccacctggag tacgtggcat gcaggcctgc ctgcagatca agatcccaac      2040
     accgcccaac tgatggcgcg cagcctgagc ggcctcgtgt cacaggtgtg tgacgaggtc      2100
     tactcgcaga cgccacatat ccgcaacgag atgcttggcc ggcatgcgct caccagccag      2160
     gccgcccgag cacgcagcga tctcctcgac gcgatgttga cttcctcggg taagcaggac      2220
     cttggcttcc ccaccgacaa atatggtcct gagcgtgcca tgtatcgcgg cgtgctggcc      2280
     tatctcggcc tgcaccggca gaacggcgca gttcaggcgg aacagaccag cgacagcctt      2340
     ttcccgtacg gcttctcggc accaggcgac aaagatccgg agaggtacgc caagccggtg      2400
     tgggaggcgc tgcagcaggc cctcaccgag gcaaccgaac gtacctcgct cgatcatgtc      2460
     gttcgcgtcg tgatgagccc gccgttcggt gtgaaggccg gtgtctggcc cctgctcgtc      2520
     gttaccgcac tgctgatcag gaggcacgat gtagcgctgt tcgaggaagg gacgtacctt      2580
     ccgcggctga cccaagacat cgtcgaacgt ctggagaagg taccgagccg cttccaggtc      2640
     aagtacacgc cggtcagctc cgggcagcgc gccagtgttg tcaagaagct cctggtatca      2700
     ctcaaggttg agcccgcgcg atcgcaggcg ttgcgcaacc cagacatgct gtcggtcacc      2760
     cgtgcgctgc tggaacgcgt catggttctc aacaagtacg cacgacagac caagcagatc      2820
     tcgtccgacg cactcgccgt gcgtaaggcg ctggtcggat cccaagatcc ggacgatttg      2880
     ctcttcaagg cccttcccaa agcactcggt cgtgggccaa tcggtccggc tgcccgagcg      2940
     gacgctgcgg ccgttgatga gtacgtcacc aggctgaccg cggctgtcga cgagatcgct      3000
     gccatcgaca gcaaactccg cgccaaggtt gttgagaccc tggcacacga gttccgtctt      3060
     cccagcgagt tgcacgaact gcgttccact cttgccgcac gcctccgtgg cttcgccgac      3120
     gttgcactga gtgcggagct gaagggcttc gtcgactttg tactcagtga cagtttgtcc      3180
     gacgaggact ggcttgaccc gatcgttgtt cgcctgacca acagcgctct cggtgactgg      3240
     gatgatcgtg aagccgcgat gttcccccgc cgcgcacgcg agatggccgc agcactggat      3300
     cgagtcggtc acctgcaccg cacgaccgat gcaagcgctc aggaagaaaa cctagaggcg      3360
     cagctgttga ccttgacgga caaggcaggt gtcgagcagc gcacactgat ctacatgccc      3420
     gcgcgcagcc gcgcaaaggc cgagaacctc gcggcagacg ccttgaagag ggccgagaag      3480
     gcactcgggc ccgacggcgc gcggatcttg ctcgccgcac tcgcacagcg agtggccgag      3540
     gcgacgaccg tcgcaccaga gacgaaggag caggcatga                             3579
//

If you have problems or comments...

PBIL Back to PBIL home page