(data stored in ACNUC7421 zone)

EMBL: CP001630.PE582

CP001630.PE582       Location/Qualifiers
FT   CDS_pept        complement(652943..654061)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0592"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: swi:Swit_5327 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0592"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34556"
FT                   /db_xref="InterPro:IPR025248"
FT                   /db_xref="UniProtKB/TrEMBL:C6WJC4"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACU34556.1"
FT                   /translation="MADTRLAAAAHSSFARHETFAPRFGWLHKAYMRVKDNPGTFIAED
FT                   APVELGVGKNMVNAMRYWSKTFKLTREHLSEDGKTKAHIASPTWEARWLLDEDGADPYL
FT                   EDPGSLWLLHWWLVSSRPGAKCWAPTWYTAFHLAPFSRFSVVEMTQVVMRHVNFSFPEG
FT                   PVEASVTKDVDCLTKMYARTPAEQPAARTTDTKTGAKSNFEDLLACPFRELDLLTPVGS
FT                   RGNQQWQFTTGTRNSLPASVLVYACLDYAARDTSSSGSISLARLANEPGGPGRAFRVRE
FT                   PEIVAALDKVAAERADVSRVDAVGQRSMSFSGDPFVLAWDVLDEQYGYVTHRPGFPTRR
FT                   EWDQKYPMLAKVAMAESQQQKHQPLALMEEIA"
     atggcagaca caaggctcgc ggcagcagca cactccagct tcgcgcgcca tgaaaccttc        60
     gcaccgcgct tcggctggtt gcacaaggcg tacatgcggg tgaaagacaa ccctggcacc       120
     ttcatcgccg aggacgcgcc cgtcgagctc ggcgtgggca aaaacatggt caacgccatg       180
     cgctactggt ccaaaacgtt caagctcacc cgcgaacacc taagcgagga cggcaagacc       240
     aaggcccaca tcgcctcccc gacctgggaa gcgcgctggc tgctcgacga agacggtgcc       300
     gatccctacc tcgaggatcc gggaagcctc tggttgctgc actggtggct ggtgtcctcg       360
     cggccaggcg ccaagtgctg ggcaccgacc tggtacaccg cgttccacct cgcgccattc       420
     tcccggttct cggtagtcga gatgacccag gtcgtcatgc gccacgtgaa cttctcgttc       480
     cccgaaggtc ctgtcgaggc gtccgtcacc aaggacgtgg attgcctcac caagatgtac       540
     gcacgcaccc cggccgagca gcccgcagcg cggaccaccg acacgaagac cggggccaag       600
     tccaactttg aagacctgct ggcctgcccg ttccgcgaac tcgacctgct cacgcccgtg       660
     ggtagccgcg gaaaccagca gtggcagttc accaccggca cccgtaactc gcttcccgcg       720
     agcgtgctcg tatacgcctg cctggactac gcggctcgcg acaccagcag ctccggatct       780
     atctctctgg cccggctcgc caacgagccg ggcggaccag gcagggcgtt ccgcgtccgg       840
     gaacctgaaa ttgtcgcggc gctggacaag gtcgccgccg agcgcgcgga cgtcagccga       900
     gtcgacgcgg tcggccagcg cagcatgtcc ttcagtggtg acccgttcgt cttggcctgg       960
     gacgtgcttg acgagcagta cggatacgtc acccaccgtc caggcttccc gacccgtcgg      1020
     gagtgggacc agaaataccc gatgctcgcg aaggtcgcga tggccgagtc gcagcagcag      1080
     aagcaccagc cgcttgccct catggaggag atcgcgtga                             1119
//

If you have problems or comments...

PBIL Back to PBIL home page