(data stored in ACNUC7421 zone)

EMBL: CP001630.PE583

CP001630.PE583       Location/Qualifiers
FT   CDS_pept        complement(654119..655288)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0593"
FT                   /product="aminotransferase class V"
FT                   /note="PFAM: aminotransferase class V; aromatic amino acid
FT                   beta-eliminating lyase/threonine aldolase; KEGG:
FT                   afw:Anae109_1098 aminotransferase class V"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0593"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34557"
FT                   /db_xref="GOA:C6WJC5"
FT                   /db_xref="InterPro:IPR000192"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR016454"
FT                   /db_xref="InterPro:IPR020578"
FT                   /db_xref="UniProtKB/TrEMBL:C6WJC5"
FT                   /inference="protein motif:PFAM:PF00266"
FT                   /protein_id="ACU34557.1"
FT                   /translation="MEQSPVIYLDYNATAPTRPEALAAVVDAMHYVGNASSIHLPGQSA
FT                   AQRVDSARRQVAELLNCSPGEIIFTSGATEANNLALRAAHSSGRRLVTSNVEHPAVLET
FT                   ARDLTADQPGSLILLEVDADGLVDLAALENALGHGDIGLVSLMAANNETGVLTDLAPVV
FT                   TAAHAVGALVHTDATQMVGRLPIDLADLDVDLLSLSAHKFGGPQGIGALFVRRTASIPF
FT                   RPQVTGGGQERGWRAGTLNVPGIAGVGAAAAAVHRSLAEETARIGRLRDLLEHAVSASI
FT                   DGYRVNGHRVARLPGVSSITFPGAPADAVMAAMPHVAVSDGSACASGAPSPSHVLLAMG
FT                   INRHDADCTLRFSLGYATTEDHIMQAADATAHAVKLVRASMDACTPIPG"
     ttggagcagt cgccggtgat ctacctcgac tacaacgcga cggcacccac ccgtcccgaa        60
     gcgctcgcgg ccgtggtcga cgcgatgcac tacgtgggca atgcttcaag catccacctg       120
     cctggtcaaa gcgccgcgca acgcgtcgac agcgcccgtc ggcaggtggc cgaactccta       180
     aactgctcgc ccggcgagat catctttaca tccggtgcga cggaagccaa caacctggcg       240
     cttcgcgcgg cgcactctag cggacgccga ctggtcacga gcaacgtcga gcacccggca       300
     gtgctcgaaa cggcccgcga tttgactgcg gatcaacctg gttcgctgat cctgcttgag       360
     gtcgacgctg atgggctggt ggacctggcc gctctggaga acgcgctggg ccacggcgat       420
     attgggctgg tatcactcat ggcggcgaac aacgaaaccg gtgttctcac cgacctcgct       480
     cccgtggtca ccgcagctca tgctgtggga gctcttgtcc acaccgatgc gacacagatg       540
     gtcggtcgcc tgccgatcga cctcgccgac ctcgatgtcg acctgctgtc cttgtcggcg       600
     cacaagttcg gcggccctca agggatcgga gcattgttcg tgcgccggac cgcgtcgatt       660
     ccgttccggc cccaagtcac cggtggtgga caggaacgag gatggcgcgc tggcacacta       720
     aatgtgcctg gcatcgcggg ggtaggtgcc gctgccgccg ccgtgcaccg cagcctcgcc       780
     gaggaaacag cccgcatcgg ccggttgcgt gacttgcttg agcacgccgt ctcagcatcc       840
     atcgacgggt acagggtgaa cgggcatcga gttgctcgac tgccgggagt cagcagcatt       900
     accttccccg gtgctcccgc tgatgccgtg atggctgcca tgccacacgt ggcggtgtcc       960
     gacgggagtg cctgcgcatc aggagcgccc agccctagcc atgtcctgct cgccatgggg      1020
     atcaaccgac acgacgccga ctgcacactg cgcttctcat tgggctacgc cacgaccgag      1080
     gaccacatca tgcaggccgc cgacgcgacc gcgcacgccg tcaagctggt ccgggcctca      1140
     atggatgcgt gcacaccaat tccaggctga                                       1170
//

If you have problems or comments...

PBIL Back to PBIL home page